SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074051 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074051
Domain Number 1 Region: 334-472
Classification Level Classification E-value
Superfamily TRAF domain-like 3.11e-31
Family MATH domain 0.00046
Further Details:      
 
Weak hits

Sequence:  FBpp0074051
Domain Number - Region: 40-117
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000412
Family MATH domain 0.042
Further Details:      
 
Domain Number - Region: 112-315
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074051   Gene: FBgn0030748   Transcript: FBtr0074275
Sequence length 474
Comment type=protein; loc=X:join(16309457..16309618,16309690..16310118,16310188..16310596,16310652..16310767,16310828..16311136); ID=FBpp0074051; name=Traf-like-PA; parent=FBgn0030748,FBtr0074275; dbxref=FlyBase:FBpp0074051,FlyBase_Annotation_IDs:CG4394-PA,GB_protein:AAN09408.1,REFSEQ:NP_727976,GB_protein:AAN09408,FlyMine:FBpp0074051,modMine:FBpp0074051; MD5=d6b7846b5d49b88a7743063ab88c90cc; length=474; release=r5.30; species=Dmel;
Sequence
MSLTKSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYEKSSCLFCNEWFDAQTFTEHLIHC
GQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQ
DVGTIRSVLNEEIRQRLHLITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAF
AIEQNQLDVQYCCDITQSLKEQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIF
ENERLNREKFFQIEEFLQQINEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCD
KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSA
MFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT
NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK
Download sequence
Identical sequences Q8IR14
7227.FBpp0074051 FBpp0074051 NP_727976.1.81976 FBpp0074049 FBpp0074051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]