SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074075 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074075
Domain Number 1 Region: 186-301
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 1.57e-36
Family eIF-2-alpha, C-terminal domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.09e-32
Family eIF2alpha middle domain-like 0.0000885
Further Details:      
 
Domain Number 3 Region: 11-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.86e-18
Family Cold shock DNA-binding domain-like 0.0000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074075   Gene: FBgn0261609   Transcript: FBtr0074300
Sequence length 341
Comment type=protein; loc=X:complement(16339588..16339918,16340218..16340912); ID=FBpp0074075; name=eIF-2alpha-PA; parent=FBgn0261609,FBtr0074300; dbxref=FlyBase:FBpp0074075,FlyBase_Annotation_IDs:CG9946-PA,GB_protein:AAF48615.1,REFSEQ:NP_573130,GB_protein:AAF48615,FlyMine:FBpp0074075,modMine:FBpp0074075; MD5=e3f0b632583d5204c5d718cb0d2136ca; length=341; release=r5.30; species=Dmel;
Sequence
MALTSRFYNERYPEIEDVVMVNVLSIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINK
LIRVGKTEPVVVIRVDKEKGYIDLSKRRVSPEDVEKCTERFAKAKAINSLLRHVADILGF
EGNEKLEDLYQKTAWHFEKKYNNKTVAYDIFKQSVTDPTVFDECNLEPETKEVLLSNIKR
KLVSPTVKIRADIECSCYGYEGIDAVKASLTKGLELSTEELPIRINLIAPPLYVMTTSTT
KKTDGLKALEVAIEHIRAKTSEYDGEFKVIMAPKLVTAIDEADLARRLERAEAENAQVAG
DDDEEDGADQEGMQFDPEKEFNHKGSGAGRANEEDEEEEED
Download sequence
Identical sequences P41374 X2JFR6
FBpp0074075 7227.FBpp0074075 NP_001285329.1.81976 NP_573130.1.81976 7293233___KOG2916 FBpp0074075 FBpp0074075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]