SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074385 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074385
Domain Number 1 Region: 613-678
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-23
Family PHD domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074385   Gene: FBgn0030945   Transcript: FBtr0074614
Sequence length 686
Comment type=protein; loc=X:complement(18544860..18546820,18546897..18546996); ID=FBpp0074385; name=Ing3-PA; parent=FBgn0030945,FBtr0074614; dbxref=FlyBase:FBpp0074385,FlyBase_Annotation_IDs:CG6632-PA,GB_protein:AAF48868.1,REFSEQ:NP_573316,GB_protein:AAF48868,FlyMine:FBpp0074385,modMine:FBpp0074385; MD5=da1c8a243f1fede3b034bc35ce9a3ca5; length=686; release=r5.30; species=Dmel;
Sequence
MLYLEDYLEMIEHLPQELRDRFTEMRELDLAVQNNMDSLDKKAHMFFKQCKRDELQHESM
DTEFHSLRGEYFKVMEDADEKVAIATQIHELVERYLRRLDSELFKFKCELEADNNGITEI
LERRSLELDGNSTAATALLLSMNQKENRYYGASSANTMVNSSTGHATGAATGSSGIALVS
GAAGTGGALSSISTAQLGSSQRHRKLEKRRETICTVPVQEKRANLNHSLPVVGSGSTTAA
AASSSSATTAAAAASLASATTAQTHVSNHIGSIAATHLTLPVAMGVAGGSSSLASSSLAT
GTGSLVRQLPTNLTHTVLSTSGGATAAAAAGGNSTSVVAAGTAHGHAHVSGHSAAGATVT
YNLQQLGGGAAASSAIAAAASQAIVATQQMQQGRRTASLKASYEAIHGTAGTTTDFWTQA
GQGGLQQSTAGSVTVAAGTALATGAAGGSSTGSHHSHHSQSHHGGHGHGHGHGHGHGHGH
GHHSSSGHGGGHSSHHQEKKQKKKLTTALTLPTVQPTAGSSSGNSIGSSSSISLESVNKL
TTSAALAAASATTTYMSVGGQALLAMTPGGGGGGNLAESSAEGVPAGMIAMNLPTTTVTP
GSSLTIGENGLVVEQTNEGEWSYDPNEPRYCTCNQVSYGDMVACDNDACPYEWFHYPCVG
ITQPPKGKWYCPKCTASMRRRGNRKN
Download sequence
Identical sequences Q9VWS0
FR567 7227.FBpp0074385 NP_573316.1.81976 FBpp0074385 FBpp0074385 FBpp0074385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]