SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074588 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074588
Domain Number 1 Region: 1543-1814
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.09e-68
Family Rap/Ran-GAP 0.00062
Further Details:      
 
Domain Number 2 Region: 53-142,203-262,306-610,686-897
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000151
Family PHAT domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074588   Gene: FBgn0005198   Transcript: FBtr0074819
Sequence length 1847
Comment type=protein; loc=3L:join(20122409..20122463,20122525..20122655,20122721..20122972,20123032..20123168,20123226..20123400,20126603..20126809,20126864..20127778,20127848..20128454,20128521..20128720,20128778..20129034,20129095..20131168,20131230..20131373,20131479..20131649,20131705..20131800,20131865..20131987); ID=FBpp0074588; name=gig-PA; parent=FBgn0005198,FBtr0074819; dbxref=FlyBase:FBpp0074588,FlyBase_Annotation_IDs:CG6975-PA,GB_protein:AAF49066.1,REFSEQ:NP_524177,GB_protein:AAF49066,FlyMine:FBpp0074588,modMine:FBpp0074588; MD5=68af192fdd3053400b072515a674571d; length=1847; release=r5.30; species=Dmel;
Sequence
MNSKDKSKFKLFLKSLPAGYVGERTLRPEFERELRPEQPVAQRCRMLKELGDTQLHNFNL
DESAITILFNLTNDLIVPNKPAETRQIALSFYKRLIHTQYKNLTIMREKFFLVIQNHEAR
EDLRHLLELLDTLTDNGKDITNFEEKIGKFMLLWIPAITEANLLTPYLDILVNLIKFNAA
HLDKDILVGIVQNACDLSCSVTVNEIGLQCLTILEMVIGYTIFPSEPLPQCITTLCRTVN
HAPYCPSSFKIMKNLLGTQLGYHSMKMMCSILNDRALYDDAHLLRGAVFHLNMNIFGSNI
IFQVSPMTYATNVLTAFLRALDSRQVIVTFEVILSVRMVITKRQLSEIIWDLICDIMSSI
VSNIEYYEEVNINKDRLHHLQINFHENIDCIEKLLQQDRSQILGNVERIYDLIERVADRR
PEASVLALIEYRSRRVTATRPDWLQVLAQFVRRYYRMSNVNVRIKTIEALVQIMDQNRAC
YEEEILSRVVLVHLSHIHLESSVQVRVAVARALSNFATHCDTKRCMDLLDILEALINRPF
EHTRHGSSSGEGTLAEVTFGLVNNESEISDIIAAVDGLVKVFAIKLHRLPGIHALKIFNI
LMDHLELHYERPKIFEHISVVRYKIFAWLLKARANGSYHIGYPEGSTEVVKFSPYLGIDS
PLLPQAHPTAISIRRVCKLIVRCLEHDTDYQVFQLVIRELPKVLQNKALVQGNDIEELAN
TLLKINLVSNNKFKRPTDEFHALVLPAIASLVIYHESLQPQQHYGIITALNSRVLTGIAS
VCINTMTILILEMPEALMRKLPDVLLQMSKMSDTNALATPVLEFLSLLIHLSKHLFANFT
SMHNMYVFAITLPYTKPHRYDHYTVSLAHHVIAGWFLKCKLELRRNCVNYIKSSIQSNAK
MLSSDIVNLNSLNEDSSNRKRSTSLTERGSRNNANAWNDLEMRPQMNNGLRNFHAELAET
CFDFLARHTYSPCPSMPKRLPAAEFLLKDGVSQTWLVGNNLVTITTSGCPSAPARSGLCE
RCAQLGKAPSISLNSKSLSDAAPPLSPERERRYTKVSLQHSSGNESAGSTELTSSSSSNS
AAAGGHPHRQISNSSTASLDALSRRGSNPEALGSALGEGAHTGSNTSLLGNSLSQSSVSM
SPSSGSVVQQPVCVRACTGWAEVLVRRPTGNVSWITRIQNPITNDCFGQELPFNNVVSLF
LPTAHGGVFGPDNTIQAPPHTLADPEPEPEAEVNAATAPQASALRSRMVAKARALQRQEE
IHSVGGNGNGNGNGNGSGNAPSTGGAAAIPIPRVPASGKRGKEAALCGSVSDGEADDDSL
AFEDAQSRARNPVRRVNSSPEMSSSWRQSFLTNKPTPLSQEPVKTTADEPQSLLTLKKKT
VQYSTKDMRVSCEAIPEEIAGSTPPSQAAALALQPESGTLPPKQHSADDVSSHVAGGSNL
QAGGSTLKLGKPPLSPGQPPLLGTGRVTSFGGTSVPQPGALAKSSSSGSNGTNVGVITSD
YDNGNNGNGDMMRGRSKTISVVREVNNGNTRPPPASSFRNFGAAKPPINTKLCMNPSFIF
MQLYTTGQLGVTDEPLKVGPENSSAVSLIDLVPPFETHKIGVLYVGQGQCNNEVEILRNS
HGSARYVEFLRNIGTLVSLKEAEQNNLFIMLDRNGADGKFAYIWKDDILQVTFHVATLMP
TNLQDDPNCNEKKSHIGNDFVKIIYNESGEEYNLNTISGQFNYACVIVEPLDLNSNRVYV
KARSEISKFVCHAEYRIVSDRSAPLLARQMALHANLASLVYQSVQKKHPYASNWLERLRK
LKRLRSKLIEGLNSQQKSGSASSGIGINASAIGSDMDDQRGDFIKYT
Download sequence
Identical sequences Q9VW83
NP_524177.1.81976 FBpp0074588 7227.FBpp0074588 FBpp0074588 FBpp0074588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]