SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074675 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074675
Domain Number 1 Region: 3906-4121
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-34
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 3282-3386
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 3178-3281
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-30
Family Cadherin 0.0008
Further Details:      
 
Domain Number 4 Region: 3382-3491
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.00041
Further Details:      
 
Domain Number 5 Region: 965-1080
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 2870-2983
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.00063
Further Details:      
 
Domain Number 7 Region: 1284-1397
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 867-969
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-26
Family Cadherin 0.00088
Further Details:      
 
Domain Number 9 Region: 2561-2670
Classification Level Classification E-value
Superfamily Cadherin-like 6e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 1603-1704
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-25
Family Cadherin 0.00082
Further Details:      
 
Domain Number 11 Region: 2326-2434
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 392-504
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 1184-1296
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 1071-1203
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-23
Family Cadherin 0.00094
Further Details:      
 
Domain Number 15 Region: 1806-1929
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 16 Region: 168-300
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-23
Family Cadherin 0.0039
Further Details:      
 
Domain Number 17 Region: 763-874
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 1496-1601
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 19 Region: 2125-2232
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 3487-3609
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 21 Region: 498-610
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 22 Region: 1410-1503
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 23 Region: 3077-3185
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-18
Family Cadherin 0.0014
Further Details:      
 
Domain Number 24 Region: 2977-3075
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-18
Family Cadherin 0.0021
Further Details:      
 
Domain Number 25 Region: 2663-2769
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-16
Family Cadherin 0.0018
Further Details:      
 
Domain Number 26 Region: 1710-1812
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 27 Region: 2234-2338
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.0027
Further Details:      
 
Domain Number 28 Region: 2458-2556
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000004
Family Cadherin 0.0042
Further Details:      
 
Domain Number 29 Region: 603-700
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000113
Family Cadherin 0.0023
Further Details:      
 
Domain Number 30 Region: 1922-2021
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000799
Family Cadherin 0.0035
Further Details:      
 
Domain Number 31 Region: 2775-2868
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000171
Family Cadherin 0.0056
Further Details:      
 
Domain Number 32 Region: 2030-2137
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000485
Family Cadherin 0.0054
Further Details:      
 
Domain Number 33 Region: 3601-3696
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000414
Family Cadherin 0.0048
Further Details:      
 
Domain Number 34 Region: 4237-4279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000408
Family EGF-type module 0.01
Further Details:      
 
Domain Number 35 Region: 59-180
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000642
Family Cadherin 0.0032
Further Details:      
 
Domain Number 36 Region: 4131-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000212
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 37 Region: 289-397
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000771
Family Cadherin 0.021
Further Details:      
 
Domain Number 38 Region: 4167-4206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 39 Region: 4209-4247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.007
Further Details:      
 
Domain Number 40 Region: 3882-3925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000434
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074675   Gene: FBgn0261574   Transcript: FBtr0074906
Sequence length 4705
Comment type=protein; loc=3L:join(20001935..20005352,20005411..20005517,20005576..20005783,20005839..20005900,20005965..20006120,20006183..20006555,20006618..20007626,20007682..20007867,20007927..20008101,20008158..20008420,20008478..20009207,20009269..20009446,20009509..20010407,20010473..20010781,20010844..20016148,20016211..20016492,20016551..20016739,20017256..20017387,20017449..20017585); ID=FBpp0074675; name=kug-PA; parent=FBgn0261574,FBtr0074906; dbxref=FlyBase:FBpp0074675,FlyBase_Annotation_IDs:CG7749-PA,GB_protein:AAF49078.2,REFSEQ:NP_649171,GB_protein:AAF49078; MD5=2ed3d1d037a46fc0c60987d90a060056; length=4705; release=r5.30; species=Dmel;
Sequence
MKIKKYVTPVKRKAFTILQWISLLCSLWLIPTVQSKADEKHTATLEYRLENQLQDLYRFS
HSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDF
AFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLF
YPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQ
LQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTS
NPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQH
FIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLK
VSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANV
GSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYIS
YSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVV
KDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDP
TSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFE
CRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINE
SVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEY
VLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATD
ADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE
ALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEET
QDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENR
FAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQG
SITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVT
EASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQA
EHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHA
IDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKS
QTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNI
SNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNP
PQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGN
VIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPE
SAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEY
MLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARS
SSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIII
HILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYH
IVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVI
NVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYT
GIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAF
ENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRL
FVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVK
AIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPC
SSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQ
SFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIES
DIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYL
KTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITGRILCRFISYKLIYDSIIPVKDLND
NAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTG
VISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENL
LHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVV
LLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIV
DNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFH
SEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGNYTFKFSIAADQDHF
MISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTF
YSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTS
LDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGT
VLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATD
GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYL
SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDIND
NMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGI
IRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILE
NATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFY
FLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATD
EDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRC
NSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIR
SGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQY
PPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNN
TGKIYAISNLDIGLYKLNVSVSDGKFHVFSIVKINVELVTNDMLKESVVIRFRRISASEF
LLSHRKTFMRSIRNIMRCRQKDVILITLQSDYQKASQHAVGNRRARSIDSDLNVVFAVRK
QQIIPDSDEFFTSDEIRQTLIDKKNEIENETNLVVEDVLPSTCQSNKNDCVHGECKQILQ
ILKNNVTTTFTDVISFAAPSYIPVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSG
SALGYQCVCPKGFSGTYCERKSSKCSNESCDMGLFTAVSFGGKSYAHYKINKVKAKFTLE
NGFSYSLQIRTVQQTGTLLYASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSINISDG
EWHQISLERSLNSAKVMVDNKHVSHGSAPGVNGILNIQSNDIFVGAEVRPHPSIIGYEDI
QRGFIGCMANIKIAKESLPLYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCAN
SGICKELDTDVFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLS
GKRCEYGKFCTPNPCKNGGICEEGDGISHCMCRGYTGPTCEIDVDECENQPCGNGATCIN
EPGSFRCICPSYLTGASCGDPLYSNSISTKLKNFSIEHISGIISGVAVVLVIISCVLCCV
VLKRSSSSKRRNRLEKDKNKSSYKEANLNSLVDKDNYCKPNVKLSNLEVNQRPISYTAVP
NDNLVLSNRNFVNNLDILRSYGSAGDELENVPFEYQKVNRNKQHVNINSCHSTDADNAYK
QEWCEQMHLRTFSENKLNNELKRDFGPSVSRFSTGKLIQVEMPNVCHSSSANFVDYSALA
NGQYHWDCSDWVRKSHNPLPDITEVPGAEIADSSSLHSNDSNESKSKKAFFVHREDGDVD
PTRDIAALNEDIGSEYLDSEAESCLEPFMLPRSSNQPLSRLSSFNNIENEDYKSNTGKVY
LRHPDSYLPTMHFPSETDGESSMTEGPISRMEIKTRRTISENSEEAYLFPCTVGEIGSNS
NISVRLCEIEDSELEEFLPQQQTNN
Download sequence
Identical sequences FBpp0074675 7227.FBpp0099949 FBpp0074675 FBpp0099949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]