SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074738 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074738
Domain Number 1 Region: 1304-1518
Classification Level Classification E-value
Superfamily SET domain 1.03e-63
Family Histone lysine methyltransferases 0.001
Further Details:      
 
Domain Number 2 Region: 1842-1895
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000514
Family PHD domain 0.0061
Further Details:      
 
Weak hits

Sequence:  FBpp0074738
Domain Number - Region: 1723-1761
Classification Level Classification E-value
Superfamily Bromodomain 0.0102
Family Bromodomain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074738   Gene: FBgn0005386   Transcript: FBtr0074970
Sequence length 2217
Comment type=protein; loc=3L:complement(19584402..19584581,19584652..19584858,19584918..19586387,19586451..19591193,19591267..19591320); ID=FBpp0074738; name=ash1-PA; parent=FBgn0005386,FBtr0074970; dbxref=GB_protein:AAF49140.2,FlyBase:FBpp0074738,FlyBase_Annotation_IDs:CG8887-PA,REFSEQ:NP_524160,GB_protein:AAF49140,FlyMine:FBpp0074738,modMine:FBpp0074738; MD5=5e73b1c37da2e87ef50be4600724a6de; length=2217; release=r5.30; species=Dmel;
Sequence
MRRQQQRFWKRNAHKNPAETDSITDQSSQSKSIKSATQFSVQRSDTDGLRMRISAIRPTL
GVVATKKPPKSRKMSTQDTESGCSEAKNRAVSKKVKVKRKKLASSSGISKSDKVSKSKKS
QISAFSSDSEDDLPLKVHQQRAPRVLLSAIIQAAQSASKPTLDIGISSSDNELPNLVQAA
IKRVESDTEDTTVEGSFRKAAKDKNLPQYQSTLLQDFMEKTQMLGQTVNAKLAEEKVAKA
KEETLVQTAVPRKRRGRPKKVVPTVPAPGNSGPAINESADSGVISTTSTTQSTTPSPKMQ
NENAVPTGSLPIASSSKPKIDMAYLDKRMYATERVLYPPPRSKRRQNNKKTACSSSNKEE
LQLDPLWREIDVNKKFRLRSMSVGAASGTGASTTICSKVLAAKSGYVSDYGSVRHQRSSH
NHNSGYKSDASCKSRYSTKSCMSRRSRAKSCGYRSDCKESGKSGLRMRRKRRASMLLKSS
ADDTVEDQDILQLAGLSLGQSSEESNEYISKPSLKSLPTTSASKKYGEINRYVTTGQYFG
RGGSLSATNPDNFISKMMNQRKETPAPSKSSCKIKSRRSSAASMCSSYVSGVSRMRRRHR
RKSFSHNKSLNIDSKLLTEIEIITSTFNSRCRIQDDRLTGSSGKEKLLADANKLQATLAA
PSPAQQLTLNGGGPASTLSKPLKRGLKKRKLSEPLVDFAMLSASASGTPNGSGSSNGNTK
RRHKKSQSNDSSSPDDHKLPLKKRHYLLTPGERPPAEVAFANGKLNAEAWAAAAAAAKST
ASTKSQAQFNARSVKSALTPKKRHLLEQPTSVSGAGSSASNSPLRIVVDNNSISGGKLLD
ISPSSLCSLKQQRRGGAAKQKVSAAKDLVQLQSPAGSYPPPGVFEPSVELEIQIPLSKLN
ESVITKAEVESPLLSALDIKEDTKKEVGQRVVETLLHKTGGNLLLKRKRKKINRTGFPTV
RRKKRKVSVEQQTTAVIDEHEPEFDPDDEPLQSLRETRSSNNVNVQAAPNPPLDCERVPQ
AGEARETFVARTNQKAPRLSVVALERLQRPQTPARGRPRGRKPKNREQAEAAPQPPPKSE
PEIRPAKKRGRQPKQPVLEEPPPTPPPQQKKNKMEPNIRLPDGIDPNTNFSCKIRLKRRK
NLEAGTQPKKEKPVQPVTVEEIPPEIPVSQEEIDAEAEAKRLDSIPTEHDPLPASESHNP
GPQDYASCSESSEDKASTTSLRKLSKVKKTYLVAGLFSNHYKQSLMPPPAKVNKKPGLEE
QVGPASLLPPPPYCEKYLRRTEMDFELPYDIWWAYTNSKLPTRNVVPSWNYRKIRTNVYA
ESVRPNLAGFDHPTCNCKNQGEKSCLDNCLNRMVYTECSPSNCPAGEKCRNQKIQRHAVA
PGVERFMTADKGWGVRTKLPIAKGTYILEYVGEVVTEKEFKQRMASIYLNDTHHYCLHLD
GGLVIDGQRMGSDCRFVNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEEGEELTYDYNFSL
FNPSEGQPCRCNTPQCRGVIGGKSQRVKPLPAVEAKPSGEGLSGRNGRQRKQKAKKHAQR
QAGKDISSAVAVAKLQPLSEKEKKLVRQFNTFLVRNFEKIRRCKAKRASDAAATASSPAL
GTTNGDIPGRRPSTPSSPSLAAQISALCSPRNIKTRGLTQAVHDPELEKMAKMAVVLRDI
CSAMETLKMSDLLTTVSSKKKKPIKTTLSGKLGSTAATSKVEFRSIQAQVEQGHYKTPQE
FDDHMQQLFVEAKQQHGDDEGKEKALQSLKDSYEQQKIASYVQLVEILGDSESLQSFKPK
EVLSSEEEPGKIAVKKSPGAKERDSPIVPLKVTPPPLLPIEASPDEDVIRCICGLYKDEG
LMIQCSKCMVWQHTECTKADIDADNYQCERCEPREVDREIPLEEFTEEGHRYYLSLMRGD
LQVRQGDAVYVLRDIPIKDESGKVLPTKKHTYETIGAIDYQECDIFRVEHLWKNELGKRF
IFGHHFLRPHETFHEPSRRFYPNEVVRVSLYEVVPIELVIGRCWVLDRTTFCKGRPMECN
DEDHCYICELRVDKTARFFSKAKANHPACTKSYAFRKFPEKIKISKSYAPHDVDPSLLKT
RKQKTELDVGAGPTTMHKVSGRQEQHQAKMVGRKPRGISAPADATAVHVVTPVAPNKQML
KKRKSRLENVLITMKLKCLDAQTAQEQPIDLSYLLSGRGARQRKTQQSSSSSTANST
Download sequence
Identical sequences 7227.FBpp0074738 FBpp0074738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]