SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074739 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074739
Domain Number 1 Region: 227-398
Classification Level Classification E-value
Superfamily alpha/beta knot 1.77e-27
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0039
Further Details:      
 
Domain Number 2 Region: 119-214
Classification Level Classification E-value
Superfamily L30e-like 9.18e-17
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074739   Gene: FBgn0036889   Transcript: FBtr0074971
Sequence length 407
Comment type=protein; loc=3L:complement(19582295..19582442,19582503..19583578); ID=FBpp0074739; name=CG14100-PA; parent=FBgn0036889,FBtr0074971; dbxref=GB_protein:AAF49141.1,FlyBase:FBpp0074739,FlyBase_Annotation_IDs:CG14100-PA,REFSEQ:NP_649130,GB_protein:AAF49141,FlyMine:FBpp0074739,modMine:FBpp0074739; MD5=d223cf4acbb8e68576a382edf0e52a73; length=407; release=r5.30; species=Dmel;
Sequence
MLCNIFKRSLQANIRNVNNLNVLRLSSSSGPRGEIQDALDIEANLFGNSDLRHEPMNTRE
ALRKNRFAGRKPKVPFASVASRNLSAPSNPAPRVAPTPAPVIKDNELNLEFVRLTLQDPL
TSTLLTTVRSRKRRDKNRQIIVEGRRLIQEALQCGLKMEVLLFSQKDQLALVKEEVGVAQ
VETGTKIYKVPQHDLKTWSSLVTPPGLMAIFDRPSDKGLEKNLAEQQRLGSQPFPITVVC
DNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCGGQFRVPIRDDVTWDEL
ALTIPPEAADDCHVFIAETNQRKRENNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRF
LNLVGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRKLIHQASEKE
Download sequence
Identical sequences H0RNK5 Q9VW14
FBpp0074739 FBpp0074739 NP_649130.2.81976 7227.FBpp0074739 FBpp0074739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]