SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074870 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0074870
Domain Number - Region: 175-224
Classification Level Classification E-value
Superfamily TPR-like 0.0253
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074870   Gene: FBgn0036795   Transcript: FBtr0075103
Sequence length 535
Comment type=protein; loc=3L:join(18598572..18598774,18598833..18599135,18599220..18599404,18599472..18600088,18600150..18600449); ID=FBpp0074870; name=CG18233-PA; parent=FBgn0036795,FBtr0075103; dbxref=GB_protein:AAF49254.2,GB_protein:AAF49254.1,FlyBase:FBpp0074870,FlyBase_Annotation_IDs:CG18233-PA,REFSEQ:NP_649044,GB_protein:AAF49254,FlyMine:FBpp0074870,modMine:FBpp0074870; MD5=859b4e54ef888084bcd67f2236f35475; length=535; release=r5.30; species=Dmel;
Sequence
MLNVVRAAAVLILVQSIHSTDPNDFLNRKYYSSSVLGLVKLLKMEQEFMVNFSIYANILQ
EKVDNLNIFLDALKRPNHKTHNEREKFVSNPLNAFGLIRRLNQDWPKLQNYTQKPLGLEQ
LTAMQDIVSAAPESFDMNEKLKAMHRIETTYDLQPKDIAKGLLQRTEFNYRLLFRDCLAL
AYHKFEIGEFKRSLLWFQEALKLSTDGSLEIMNRLKEIELKGFATAVAKRSIYLSNQGLT
NETIDDMANSQLQDAKLMDLEQLISSELKQWINDDSTTPPTDHNLGCRGLFPKKSNLVCR
YNSSTNAFLKLAPLKMEEISRDPYIVMFHEVISDKDIEEMKGEITEMENGWTSLGDPKEI
VSRVYWIRKESSFSKRINQRISDMTGFKLEEFPAIQLANFGVGGYFKPHYDFYTDRLKEV
DVNNTLGDRIGSIIFYAGEVSQGGQTVFPDLKVAVEPKKGNALFWFNAFDDSTPDPRSLH
SVCPVLVGSRWSEYYEKMLYSSRHNYEYILSAITKWLHYAPQLFVKPCSPRVHLE
Download sequence
Identical sequences 7227.FBpp0074870 FBpp0074870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]