SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075083 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075083
Domain Number 1 Region: 53-120
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000592
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075083   Gene: FBgn0036661   Transcript: FBtr0075324
Sequence length 143
Comment type=protein; loc=3L:join(16773757..16773890,16774563..16774685,16774764..16774938); ID=FBpp0075083; name=CG9705-PB; parent=FBgn0036661,FBtr0075324; dbxref=FlyBase:FBpp0075083,FlyBase_Annotation_IDs:CG9705-PB,GB_protein:AAN11740.1,REFSEQ:NP_730197,GB_protein:AAN11740; MD5=f5223db465788751542e616517373054; length=143; release=r5.30; species=Dmel;
Sequence
MTEPRTPEKLLAAKPPVLHHNSHSPNASLQLPSPIITRRTRTASTSARALENPVVTGMVK
SFSRTKGHGFITPNAGGEDVFCHVSDIEGEYVPMPGDEVKYRLCAIPPKYEKHQAVHVQI
SHLTPEVHHKWEEPFYGGSSPAK
Download sequence
Identical sequences M9PFS8 Q9VVA0
FBpp0075083 FBpp0075083 FBpp0075084 FBpp0305784 7227.FBpp0075084 NP_001261972.1.81976 NP_648920.1.81976 NP_730197.1.81976 FBpp0075083 FBpp0075084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]