SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075092 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075092
Domain Number 1 Region: 126-312
Classification Level Classification E-value
Superfamily TRAF domain-like 1.57e-59
Family SIAH, seven in absentia homolog 0.0000000208
Further Details:      
 
Domain Number 2 Region: 66-127
Classification Level Classification E-value
Superfamily RING/U-box 0.000000544
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075092   Gene: FBgn0003410   Transcript: FBtr0075333
Sequence length 314
Comment type=protein; loc=3L:16849518..16850462; ID=FBpp0075092; name=sina-PB; parent=FBgn0003410,FBtr0075333; dbxref=FlyBase:FBpp0075092,FlyBase_Annotation_IDs:CG9949-PB,GB_protein:AAN11744.1,REFSEQ:NP_730206,GB_protein:AAN11744; MD5=62ba3a5495afbf6dffe424e4b7d9240e; length=314; release=r5.30; species=Dmel;
Sequence
MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGD
AGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAME
KVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHL
MMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAI
VQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFA
DNGNLGINVTISLV
Download sequence
Identical sequences B4PK89 P21461 P61093 X2JB60
FBpp0264891 FBpp0075091 FBpp0075091 FBpp0075092 NP_001287089.1.81976 NP_476725.1.81976 NP_730206.1.81976 XP_001973003.1.56816 XP_002095075.1.41174 7227.FBpp0075092 7245.FBpp0264891 FBpp0075091 FBpp0075092 FBpp0132130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]