SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075168 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075168
Domain Number 1 Region: 6-334
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.68e-58
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000404
Further Details:      
 
Domain Number 2 Region: 361-524
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-43
Family Myf domain 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075168   Gene: FBgn0027080   Transcript: FBtr0075410
Sequence length 525
Comment type=protein; loc=3L:complement(16410583..16410829,16410889..16411212,16411275..16411641,16411704..16412343); ID=FBpp0075168; name=Aats-tyr-PA; parent=FBgn0027080,FBtr0075410; dbxref=FlyBase:FBpp0075168,FlyBase_Annotation_IDs:CG4561-PA,GB_protein:AAF49462.1,REFSEQ:NP_648895,GB_protein:AAF49462,FlyMine:FBpp0075168,modMine:FBpp0075168; MD5=35c93e64aa3942ccfa657be1997eb4f4; length=525; release=r5.30; species=Dmel;
Sequence
MVGITPAEKKALITRNLQETLGDDKLTKILAERDLKIYWGTATTGKPHVAYFVPMSKIAD
FLKAGCEVTILFADLHAYLDNMKAPWSLLELRTKYYEQVIKAMLSSIGVPLEKLKFVKGS
DYQLSKEYTLDVYKLSSVVTQHDAKKAGAEVVKQVEYPLLSGLLYPGLQALDEEYLKVDA
QFGGVDQRKIFTFSEKYLPQLGYEKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDSPANV
KKKLKKAFCEPGNIADNGLLSFVKHVLFSLFKEGEGFEVNREAEHGGDVTFLKYEDLEKY
YAEDKLHPGDLKATVEKYINRLLDPIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGAD
EDAPHRLDIRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVA
VLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNP
KKKVWEKLSADFKTNSDGLAVWKDNFLLTPEGEKLSSKLANCSIK
Download sequence
Identical sequences Q9VV60
NP_648895.1.81976 FBpp0075168 FBpp0075168 FBpp0075168 7227.FBpp0075168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]