SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075260 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075260
Domain Number 1 Region: 401-603
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-63
Family Kelch motif 0.00000668
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily POZ domain 4.91e-36
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 3 Region: 318-415
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 4.18e-19
Family Galactose oxidase, central domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075260   Gene: FBgn0040230   Transcript: FBtr0075505
Sequence length 623
Comment type=protein; loc=3L:join(15821103..15821151,15821419..15822137,15822286..15822977,15823116..15823305,15823371..15823592); ID=FBpp0075260; name=dbo-PA; parent=FBgn0040230,FBtr0075505; dbxref=FlyBase:FBpp0075260,FlyBase_Annotation_IDs:CG6224-PA,GB_protein:AAF49578.1,REFSEQ:NP_524989,GB_protein:AAF49578,FlyMine:FBpp0075260,modMine:FBpp0075260; MD5=277864520d5900ab17ce9370528197a0; length=623; release=r5.30; species=Dmel;
Sequence
MGDLPGSGSTAQPRDAAVTGTGGNSTAGGGSSVGSTAVDRPPSPARLSHTSEKHPKVTLT
ELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDE
NAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPTNCLGIRAF
ADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSEEQVFNAVM
SWLKYNVAERRQHLAQVLQHVRLPLLSPKFLVGTVGSDLLVRSDEACRDLVDEAKNYLLL
PQERPLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRC
GVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLY
AVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNT
VERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSP
IVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGV
GVMRAPQTENYMWCENSFKQPNS
Download sequence
Identical sequences A0A0R1DYG0 B4HIK1 B4PD06 Q9VUU5
FBpp0075260 NP_524989.2.81976 XP_002030645.1.34323 XP_015050681.1.41174 FBpp0267291 7227.FBpp0075260 7245.FBpp0267291 FBpp0207037 FBpp0075260 FBpp0075260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]