SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075442 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075442
Domain Number 1 Region: 798-1198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-44
Family Tandem AAA-ATPase domain 0.078
Further Details:      
 
Domain Number 2 Region: 8-122
Classification Level Classification E-value
Superfamily TPR-like 0.0000199
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0075442
Domain Number - Region: 329-358
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000706
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number - Region: 277-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000852
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075442   Gene: FBgn0036451   Transcript: FBtr0075692
Sequence length 2061
Comment type=protein; loc=3L:join(14785231..14785560,14785761..14786364,14786843..14788848,14788975..14791549,14791665..14792335); ID=FBpp0075442; name=CG9425-PA; parent=FBgn0036451,FBtr0075692; dbxref=FlyBase:FBpp0075442,FlyBase_Annotation_IDs:CG9425-PA,GB_protein:AAF49702.1,REFSEQ:NP_648725,GB_protein:AAF49702,FlyMine:FBpp0075442,modMine:FBpp0075442; MD5=c0c50e6619cc2d94a3094e8bb2e86743; length=2061; release=r5.30; species=Dmel;
Sequence
MAAEKEMQAHDMVRRRSWARAVALYDQLIAPSPGQGSGGQSAGSRAQKDQQIACLLGRCE
CLLELGKFEGCLADAYKVLTLLSEQTECLASVSRARRWLVHALFKMHKYGDAEIFLSKWI
NELSGQQIYSDISKTLERYKSIIQMIMNGQHKAQALKIPHARLEDEMAILDTKLDHWATN
NLPLDKYSKLLSNKGLKKREQQQQQQQQQQQQNGNGIGSYASSSSSSSTGSSSTMSSSST
SLHKTNDLLAAMKLTAGKHQPGSGDGSGSDQGDQAAPSTTCSYCTITFQTRNELRQHCQT
EAHQKVIMSDEGRDWKWRPPPRGYTLDTYSLCETFSEAHICHYGAQCVEAHGQDELNEWK
ERFEYRRMRMQKACEKELYGKSYTEQVLDRWIQATAPERVMCERVPDMEARCEQQLVTSI
SSKTSKREWLFQLETKKPLKAVALLQDAHRNHFALKSIKMCKPTESSMELKSDQEWLAGS
SSQSETSNEDSATLIHEITVEFHTEIYGTFRQAICFDVGQEPLLVRHLCVDVLPVNDAEK
IEEIKRDIINSSATRWDVANTQLTRFETTIGTHLKTEAYLSDLEHERELLERYPCPRAAT
FTLTQSTIVEKRLTQNNYRSRIHELLSVEEIARYEQIARYNVRTRLTVASNYILTPAGMA
TSTAKYSLAGELFALMRLGKDISEDTSPGRLILSNCSSVYISKPEDPDSKADPTKRAVYE
ALIEDKGKNVIYLKLSAKCVEAMALQADTELEVDIQFQLNRMPYCEWHNAVDKITDFRLI
FPATELEPSIPWTPKKQWADSCEPKLNAKQREAVNAITTALSIKLPPILLIGPFGTGKTY
TLAQAIKQLLTQPEAKILICTHSNSAADLYIKEYLHPWIEEGLKEATPLRVYYHKRWSAT
VNGVVQKYCITDGVGNFLRPTVEDIMRHRIVVVTLSISMELATLGLPKGLFTHIFLDEAA
QAMECEAIMPLALANDSTRIILLCENYRAHEAIIRFTSELFYEQKLVASGKQPRHDRFYP
LTFFTTRGEDVQDKNSTAFYNNAEVYEVVERVSELRKRWPSAWGKLNDTSIGIMTPYSDQ
VFRIRSELRKRRMGGISVERVLNVQGKQFRAVFLSTVRTRRTCMPQGSAPGSASTTSIGD
ADADYGFLSNSKLLNTAITRAQSLVAVVGDPVALCSIGRCRKVWERFIEICDEHKSLFGL
TWSNLRSQLDGVELKRGYVLNPLAPEFVPRALQPEAYLREQAALYLNGPQHGHGGHGPPG
PPAHFANAAGMLGPGPAAAAHQMNQMAAAMAANQQQLTAHMYSTHMAMMAAAVGGKSGNG
PGPGTGGGPGPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGG
GGGPPPPYGQYPAMQHWRPPQQGQNQGPGQQPPQNPNASLWGPPPQTNPWSVLPPSKQPQ
QPQPPPVSAPGRGPGPLPPPLNANPSLPLRGGSVPPPPPNASTAAHLLRNPSELGYLAKK
SLYNHGQALPHHQLYGPGPGPPPPPSQQQPQAPPMGMQRGSSVPNGPMSPMENGPPPPPY
LRHNGSGYNPGAPPPPPQQQPQPPPNPFMYAGKQPSPSSMRFGPMTHELLPPNVSIYDMA
FNPKDEQYKWYVKLLETVGQDGANKFAEMLRQVMATMQQQQQQHKPPQPPMANNPMLNNP
HVQRPQYPMMYPQGQQQQQQQPPQQSVDASPPLENFNQQIDLVFNSIMNGANDVAQPILR
DVLGMVAGTGNAPGPPLSNGLNGVDLQQQQQQQQQQQQSRLFAMMQQQQQQQQQQQAKPP
LGPGPLYPNHLGGPGLHQAPPNGGGNLSGVGNTNFMGNAGNALLNDKPYNNVGMHNNVGL
NIGGAGVAGHNSNNNNGMLTNGNNSVPLYRRQAHTGNGIGGGNGDYNNMHGMDAGANLIE
ALFQANNSVVDHSVKSSDHMHGLLYNNFNGLKGGGHELDLFQAMAPSVPHSEAANHHQQS
SGSSATTYAAVLSQGPQAVVGGGVGTGPSPGQSQAQAGVAGSGTGGKVAPAVGRNDLLEK
DPFAAIRELGQATTGFYNYFQ
Download sequence
Identical sequences FBpp0075442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]