SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075447 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075447
Domain Number 1 Region: 178-236
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000511
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075447   Gene: FBgn0001120   Transcript: FBtr0075697
Sequence length 240
Comment type=protein; loc=3L:complement(14795579..14796273,14796332..14796359); ID=FBpp0075447; name=gnu-PA; parent=FBgn0001120,FBtr0075697; dbxref=FlyBase:FBpp0075447,FlyBase_Annotation_IDs:CG5272-PA,GB_protein:AAF49700.1,REFSEQ:NP_648726,GB_protein:AAF49700,FlyMine:FBpp0075447,modMine:FBpp0075447; MD5=771cea536d52bf31b9e94f0317705e0f; length=240; release=r5.30; species=Dmel;
Sequence
MERYNRVYRDPASPLTPLTPLSTEAFTFEDVTPTGGVGRKGTARYGLFGMPKNNNLTVPN
SRPALSGLKRLSESTLPRRFSQKFMRTRSVFSPTSQSTLINGETRLLGESGDSKLLRTKR
EDRPKPDIRLQQETRLRQEESKLKSARKIKVEDPRSPTPSIHHSRYKPCSPVEHPTLSPR
VKSLLDRTGNAHLTELFTRQEIDIEVLIQMTLEDLAALGVRGAREIRLAMNIIQLAKQFF
Download sequence
Identical sequences Q9VUI0
FBpp0075447 FBpp0075447 NP_648726.1.81976 FBpp0075447 7227.FBpp0075447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]