SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075569 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075569
Domain Number - Region: 647-690
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00247
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075569   Gene: FBgn0086916   Transcript: FBtr0075827
Sequence length 714
Comment type=protein; loc=3L:join(13166782..13166838,13167638..13169101,13169174..13169797); ID=FBpp0075569; name=snky-PA; parent=FBgn0086916,FBtr0075827; dbxref=FlyBase:FBpp0075569,FlyBase_Annotation_IDs:CG11281-PA,GB_protein:AAF49838.2,REFSEQ:NP_648633,GB_protein:AAF49838,FlyMine:FBpp0075569,modMine:FBpp0075569; MD5=31a48655fc8c206926098548fa515f70; length=714; release=r5.30; species=Dmel;
Sequence
MQRVTPPSATTLSNCTNFGSEGSTRIQCLRRFVTFLLGLVLGFLLWKLAALNFTLGRLFV
NGATDLYVFIIFVLVTGTIFMLSLPVRAVILLIFVALVGKSGRTYLRAVAFAFIISGPIA
NLVENAGEVARVFVCTTVLTYNLSKTRFDLMAKPFTNTLKHMRGDVEEIRHTFYELQEVL
VDLKYAVENSDIEDEKYGDKNTKPIYERWGRETSRMNVSEIGNGGKELPTPAAVQERFQR
NMRNRCKHQLRSGHRACLEVFRNGYRKCTTNFPSMIAKAICWPYRVDIICELDLFGNPDK
ICDPSAVVPQNFGETYVELLKAEKKLFDNSSQIVVNYEIKDEQFAKSQLKSAERTGQAFK
EDFERQKRIFNKVMGILQKILCLFMLRMVYVSINYYVKYLNDVEFDNFYITKYFKHVDQR
RKEQRIDAILPLRTYEKSKYIDVDHIFSRTHHESTTVCFNLLQFLLELVTAGLFILIDHL
VVELLQIVRKRSKIVYQQDGEHEVRFNISGVGQMARLLRTTMHNFNIHEKVSTSLSNKEC
LPNAHVLPKKMYYQLILLYLIIIVLIYQSTTFLRMRRVICSFFYYKREKQRILFLYNRIL
RNRLRSLEFLIHDAEDNLATHRIQQQVNVFLWLRFSCPVAFGWIRHFKFAKRTCMICRGL
EDSTFTVCGNCGLPYCDDCAEDLNSVCFQCGVVLTRGAEGSESSVEVYTYRKEK
Download sequence
Identical sequences FBpp0075569 FBpp0075569 7227.FBpp0075569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]