SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075697 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075697
Domain Number 1 Region: 118-352,417-471
Classification Level Classification E-value
Superfamily Kelch motif 8.63e-52
Family Kelch motif 0.0063
Further Details:      
 
Domain Number 2 Region: 62-146
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000222
Family Kelch motif 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075697   Gene: FBgn0036301   Transcript: FBtr0075965
Sequence length 509
Comment type=protein; loc=3L:complement(12528612..12529300,12529360..12529780,12529839..12530144,12530209..12530322); ID=FBpp0075697; name=CG4069-PA; parent=FBgn0036301,FBtr0075965; dbxref=FlyBase:FBpp0075697,FlyBase_Annotation_IDs:CG4069-PA,GB_protein:AAF49898.1,REFSEQ:NP_648590,GB_protein:AAF49898,FlyMine:FBpp0075697,modMine:FBpp0075697; MD5=ee6610bb0e4788272ef7d33a269cf7ee; length=509; release=r5.30; species=Dmel;
Sequence
MGKKDKNKKKGKGAEKTAMKTDKKQAARQKKMLEKLGEANIADIIQLLEAKEGKIEAISE
SVCPPPTPRSNFTLVCHPEKEELIMFGGELYTGTKTTVYNDLFFYNTKTVEWRQLKSPSG
PTPRSGHQMVAVASNGGELWMFGGEHASPSQLQFHHYKDLWKFALKSRKWERIAAPNGPS
PRSGHRMTVSKKRLFIFGGFHDNNQSYHYFNDVHIFSLESYQWLKAEIGGAIVPSPRSGC
CIAASPEGKIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKPGGY
KPKPRSSVGCTVAANGKAYTFGGVMDVDEDDEDVHGQFGDDLLAFDLTSQTWRLQEIQTK
SSSAEKKDSEESKDVEMSAVDKPVTTTTDGIFTVTVGGPSTSTTPFVSKIPSLFAKPKPT
NVPSPRMNPGMCVCKGTLYIFGGIFEEDDKQLTYNDFYALDLHKLEWKVLIPNSLKGHEW
EDSDSSSSDEECSGSEEDISSSSSDMDTD
Download sequence
Identical sequences Q9VTZ7
NP_648590.1.81976 FBpp0075697 7227.FBpp0075697 FBpp0075697 FBpp0075697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]