SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075717 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075717
Domain Number 1 Region: 254-300,460-538
Classification Level Classification E-value
Superfamily SET domain 8.01e-17
Family Histone lysine methyltransferases 0.079
Further Details:      
 
Domain Number 2 Region: 112-208
Classification Level Classification E-value
Superfamily TPR-like 0.000003
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Weak hits

Sequence:  FBpp0075717
Domain Number - Region: 293-341
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00889
Family MYND zinc finger 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075717   Gene: FBgn0036282   Transcript: FBtr0075985
Sequence length 663
Comment type=protein; loc=3L:complement(12392697..12393015,12393071..12393292,12393352..12393888,12393949..12394291,12394350..12394920); ID=FBpp0075717; name=Smyd4-PA; parent=FBgn0036282,FBtr0075985; dbxref=FlyBase:FBpp0075717,FlyBase_Annotation_IDs:CG14122-PA,GB_protein:AAF49923.1,REFSEQ:NP_648574,GB_protein:AAF49923,FlyMine:FBpp0075717,modMine:FBpp0075717; MD5=aae1b18d25c57c05360408435c895340; length=663; release=r5.30; species=Dmel;
Sequence
MEFDATYHEICSAQTVQSERRGFFNEFCVDVRDACGDKWLRNYFGKLKSNAARVLSIFSD
REVCDPVLGVLEHVQPVFKQKDALFSAQRRAQADKLYLMSGSGDGEESRELLQQALMAAN
LAVMRAPDRNADPVLDEGLTLALAYRSRASILIRLGEGEAALNDLKLAINFGLELKSSVD
YYLKMAKAYAVMGEPARAEISLKIAEKMPGCDATHIALCRKELSSVKPKPKEATSEQVPQ
LAHGESAELVGASKVVRLVETKDKGRFVVANEGLRTGDVLLFEEPVAACLEPSYFGTHCH
HCFKRLHTPVSCLHCSGIAFCSAQCMGEACSSYHRFECEYMDLMIGSGMSILCFIALRIF
TQAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGV
NPTAVELQVATALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHE
CWPSTACHFVGKKLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMA
CQENWPLLQKLDKQVRFWCTSANCSNLLKFPKDLAKDVRCPRCRKNISLKESVAKMIKIE
ELYREAARAMEAQKTVEAIELFKESLDMFFQVAALPHKDTIVAQQSLHKCLSDTGTTFKK
EGK
Download sequence
Identical sequences Q9VTX2
7227.FBpp0075717 FBpp0075717 FBpp0075717 FBpp0075717 NP_648574.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]