SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075731 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075731
Domain Number 1 Region: 49-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00063
Further Details:      
 
Domain Number 2 Region: 179-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.45e-36
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 565-585,799-962
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.15e-33
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 364-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 970-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-24
Family Laminin G-like module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075731   Gene: FBgn0013997   Transcript: FBtr0075999
Sequence length 1284
Comment type=protein; loc=3L:join(12139955..12140060,12141892..12142008,12144311..12144507,12145277..12145418,12145480..12146658,12146723..12146848,12147051..12147254,12147314..12148243,12148303..12148482,12148546..12148890,12148955..12149092,12149151..12149341); ID=FBpp0075731; name=Nrx-IV-PB; parent=FBgn0013997,FBtr0075999; dbxref=FlyBase:FBpp0075731,FlyBase_Annotation_IDs:CG6827-PB,GB_protein:AAN12252.1,GB_protein:AAN12252,REFSEQ:NP_729787,GB_protein:AAN12252,FlyMine:FBpp0075731,modMine:FBpp0075731; MD5=bd0ad7cdba80b7f0be9086754f86d914; length=1284; release=r5.30; species=Dmel;
Sequence
MRPPRSNTKAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQPLMERAVLTAT
SSLTERGPDKARLNAGTSWSAKNSDFDQRLIIDLGVVRNVTHIALQGRPHSNEYVTEYTI
SYGITDLEFADYKEPGGNVKMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRV
ELYGCDYISENLYFNGTGLVRYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYY
ALQLKDNKMVLNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQ
GEFTRLNLNRELYLGGVPNVQEGLIVQQNFSGCLENIYFNSTNFIRVMKDSTELGEGYLF
TRVNTIYACPSPPIYPVTFTTRSSFVRLKGYENSQRLNVSFYFRTYEETGVMLHHDFYSG
GYLKVFLEFGKVKIDLKVKDKARIILDNYDDQFNDGKWHSFVISIEKNRLILNIDQRPMT
TTKSMQVATGAQYYIAGGKDKNGFVGCMRLISVDGNYKLPQDWVKGEEVCCGDDVVVDAC
QMIDRCNPNPCQHKGLCHQNSREFFCDCGHTGYAGAVCHTSNNPLSCLALKNVQHVQQRV
NLNLDVDGSGPLEPFPVTCEFYSDGRVITTLSHSQEHTTTVDGFQEPGSFEQSIMYDANQ
LQIEALLNRSHSCWQRLSYSCRSSRLFNSPSEAGNFRPFSWWISRHNQPMDYWAGALPGS
RKCECGILGKCHDPTKWCNCDSNSLEWMEDGGDIREKEYLPVRAVKFGDTGTPLDEKMGR
YTLGPLRCEGDDLFSNVVTFRIADASINLPPFDMGHSGDIYLEFRTTQENSVIFHATGPT
DYIKLSLNGGNKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIK
AEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEYSKRGLYGIST
GCVGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICADEIGVNLRSSSIIRYEFEGSF
RSTIAENIRVGFTTTIPKGFLLGFSSNLTGEYLTIQISNSGHLRCVFDFGFERQEIIFPK
KHFGLGQYHDMHFMRKNGGSTVVLKVDNYEPVEYNFDIKASADAQFNNIQYMYIGKNESM
TDGFVGCVSRVQFDDIYPLKLMFQQNPPKNVKSLGTQLTEDFCGVEPVTHPPIEIETRPP
PLVDEEKLRKAYNEVDSVLLACLLVILFLLLILMFFLIGRYLHRHKGDYLTHEDQGADGA
DDPDDAVLHSTTGHQVRKRTEIFI
Download sequence
Identical sequences Q8IQH0
FBpp0075731 NP_729787.2.81976 FBpp0075731 FBpp0075731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]