SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075759 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075759
Domain Number 1 Region: 58-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.88e-21
Family Cold shock DNA-binding domain-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075759   Gene: FBgn0022959   Transcript: FBtr0076027
Sequence length 352
Comment type=protein; loc=3L:complement(12115207..12115254,12115776..12115873,12115937..12116674,12117812..12117986); ID=FBpp0075759; name=yps-PA; parent=FBgn0022959,FBtr0076027; dbxref=FlyBase:FBpp0075759,FlyBase_Annotation_IDs:CG5654-PA,GB_protein:AAF49961.3,REFSEQ:NP_524033,GB_protein:AAF49961,FlyMine:FBpp0075759,modMine:FBpp0075759; MD5=e40bca2842ecf7b30a38c770d1369348; length=352; release=r5.30; species=Dmel;
Sequence
MADAAESKPLAAEQQQAQQQPEQQQNPPNPQEQDHEQEPLDELQGQQGQPAPPTKEVIAT
KVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGE
KGNEAANVTGPSGEPVRGSQFAADKRRNFRPWMKKNRRKDGEVEGEDAESSAQQQQQQAA
PIVDGQPQQQVQSGPRQPRQNFRRGPPGGPPGGPRGGPRGPPGGAPGGPRRYNNYYLRQP
RRGLGGGDGSAEPGVHDQNPEGLQRGEGQGPRRGGGPPGGPQRRFFRRNFNNGPPPPRRD
GGEYIQGQGPPRPQQPRPRRQRKPNGPGGGSEQQPEKNGAQELQNTTTESTA
Download sequence
Identical sequences Q95RE4
NP_524033.2.81976 7227.FBpp0075759 FBpp0075759 FBpp0075759 FBpp0075759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]