SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075789 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075789
Domain Number 1 Region: 1152-1484
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.64e-65
Family Ankyrin repeat 0.0000358
Further Details:      
 
Domain Number 2 Region: 1506-1614
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000607
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 3 Region: 628-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000816
Family RecA protein-like (ATPase-domain) 0.091
Further Details:      
 
Weak hits

Sequence:  FBpp0075789
Domain Number - Region: 91-139
Classification Level Classification E-value
Superfamily RING/U-box 0.000141
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number - Region: 653-711,754-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000282
Family RecA protein-like (ATPase-domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075789   Gene: FBgn0041096   Transcript: FBtr0076057
Sequence length 1670
Comment type=protein; loc=3L:complement(12001598..12001915,12001979..12005331,12005528..12005830,12006031..12006508,12020122..12020261,12021796..12021978,12048294..12048531); ID=FBpp0075789; name=rols-PC; parent=FBgn0041096,FBtr0076057; dbxref=FlyBase:FBpp0075789,FlyBase_Annotation_IDs:CG32096-PC,GB_protein:AAF49970.2,REFSEQ:NP_729780,GB_protein:AAF49970,FlyMine:FBpp0075789,modMine:FBpp0075789; MD5=8f36891c6c081381b8e100ed41700c2c; length=1670; release=r5.30; species=Dmel;
Sequence
MFPLTNRSSSGNRTNNNPSNNNNNQTTSFIIGGTTNINNNNNQLGGTNSAKDKGNFENNW
SCNKTTGRRSGSGNSCSFLDLQSIRRLLEHDASGSVCPSCRISFDKGKRRKLIDTCGHER
CYSCMFRNDQCPMCMNSSLKDVDGANAQGYDTGIGGSTSTIVSPLGSPQPQLRSHAQRNA
ALARYMQQHRQESQSPDYHHRYASNGKLPRAAALSTNGNGFTTGTTQTVTVDVHHQLGGG
GGGAAAAAKQLMANGISGHSRSSSMSHNIHAAAYSELSAAPPAFATPPTRRRFFNHKNLR
SALTGGSGGGSGVGGGVGGAGGVGGGHRRTASNGGCPIDTASILSGDHTHQHHHRDNQPE
GKESNALNTSTCSDSAVTRRRRKNVSNHNLKTSARHGASSENRLNRLSLAGTSVYAGHLS
SLVFGKIKSLWSVNSSNSSEAGLNQLAGSDAIDHHSSFLNEKLQKDQLHARLGLLLNDPG
SNGNSSSSGSGCEPISAHSTTSTTSSSGVGAASTTTSGSSQNVSPEQTLASGAGMLSGSQ
LSVATSHGVKEDALSLCGKFKAGCSMLHVYEALPSKSRKGNVRRSTRGQQGSSSSASAAS
AVGSRVTASSLAAVQLALKPLFFEVPLQEPDPPYVGRQWLVQQLSNILLGTETRVVLING
QPGTGKTAFCLQLVEYSCFGRRQMQDDPDGIYSQLQLGAHCERMRGLASHMVGYHFCQAD
ANLTCQVPDFVHSLAAQLCQAPQLTAYRDYLLSEPHLQDILSVRECIADAERVMKLAILE
PLAHLHRAGKIPAKVAVIVVDALCEAEYHRPDHGHTIASFLAQLTPHFPAWLKLVATVRT
QMLELVKAPSYTQLTLDSWASSQALQQDMLDYIGARLADSPEIRMNIGGGGGQNSQSGSQ
PQTKFVSHLQSLSRGSMLYAKLILDLIARGQLVIKSSSYKVLPVSLAQIFLLHFNLRFPT
ARSFEQAAPILNICLAALYPLTLDEIYYSMEALSHGREALSWPDFMQRFKLLDGFLIKRL
DNTYMFFHSSLREWLMRRDEGESNKFLCDARLGHAGIAFRLSRLQAPLSPQLTLELGHHM
LKAHLYGGTSLTLLSPRDLQSYWLAGAADNISSSLGALRNVYSPNLKVSRLVLLAGASPN
HRTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRPL
VAAGSSLGQLDITQRCALVHAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGA
AAQAHCKILEDLLDLNETEFDLDVNGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDA
RNRQGYSALWLAVKEGHWSVVEHLLQRGALLDEPLGQTRKTPLMIAAEEGHLELVDLLLA
RGAQREAQDHEGFTALSWACLRGHLAAAKTLIEHGCNRHHEDHNGRTALDLAAYQGAASL
VIYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLRKGAKLGPTTWSMAMGKPEILV
ILLNKLLEDGNVLYRKNRFQEAAHRYQYALRKISGLEQLLERNAIFAQLRTNLLLNLSRC
KRKLNELDASIDLATQAIAQKPHSYEGYYARAKARMELGALNEALVDANEAMQQAAQSGV
LCEVVEVLKRIQTELLTRISISSEDQTGRMSNIGGGASVAYESHHEITDL
Download sequence
Identical sequences Q9VTS6
FBpp0075787 FBpp0075789 FBpp0075787 FBpp0075789 NP_729780.1.81976 NP_729781.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]