The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0075941 |
| Domain Number 1 |
Region: 161-282 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Translation proteins SH3-like domain |
7.82e-31 |
| Family |
C-terminal domain of ribosomal protein L2 |
0.0005 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 42-149 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Nucleic acid-binding proteins |
5.14e-19 |
| Family |
Cold shock DNA-binding domain-like |
0.0019 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0075941 Gene: FBgn0036135 Transcript: FBtr0076211 |
| Sequence length |
294 |
| Comment |
type=protein; loc=3L:join(11114041..11114506,11114663..11115081); ID=FBpp0075941; name=mRpL2-PA; parent=FBgn0036135,FBtr0076211; dbxref=FlyBase:FBpp0075941,FlyBase_Annotation_IDs:CG7636-PA,GB_protein:AAF50091.1,REFSEQ:NP_524022,GB_protein:AAF50091,FlyMine:FBpp0075941,modMine:FBpp0075941; MD5=7de791f4e0db283b8b27270eac4c6423; length=294; release=r5.30; species=Dmel; |
| Sequence |
MQSVTRLLSTTLTIQTPFRTAPAFLQQLRGKTKVVEKPKPGAGQQFRRTVHFPEKYTVEP
LKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRDGPTEGAQEELVLEVLRDGCRTAK
VALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLEK
NPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVG
SAQRMREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTISPPAPPKEEAIKLTLPL
|
| Download sequence |
 |
| Identical sequences |
Q9VTF8
FBpp0075941 7227.FBpp0075941 FBpp0075941 FBpp0075941 NP_524022.1.81976 |
