SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075941 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075941
Domain Number 1 Region: 161-282
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.82e-31
Family C-terminal domain of ribosomal protein L2 0.0005
Further Details:      
 
Domain Number 2 Region: 42-149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-19
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075941   Gene: FBgn0036135   Transcript: FBtr0076211
Sequence length 294
Comment type=protein; loc=3L:join(11114041..11114506,11114663..11115081); ID=FBpp0075941; name=mRpL2-PA; parent=FBgn0036135,FBtr0076211; dbxref=FlyBase:FBpp0075941,FlyBase_Annotation_IDs:CG7636-PA,GB_protein:AAF50091.1,REFSEQ:NP_524022,GB_protein:AAF50091,FlyMine:FBpp0075941,modMine:FBpp0075941; MD5=7de791f4e0db283b8b27270eac4c6423; length=294; release=r5.30; species=Dmel;
Sequence
MQSVTRLLSTTLTIQTPFRTAPAFLQQLRGKTKVVEKPKPGAGQQFRRTVHFPEKYTVEP
LKITHLAGRDPVSGRLVAKGIGGGIKQQYRWVKWVRDGPTEGAQEELVLEVLRDGCRTAK
VALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCLEK
NPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGRLSNPEHNKEHVG
SAQRMREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTISPPAPPKEEAIKLTLPL
Download sequence
Identical sequences Q9VTF8
FBpp0075941 7227.FBpp0075941 FBpp0075941 FBpp0075941 NP_524022.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]