SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076239 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076239
Domain Number 1 Region: 129-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000733
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Weak hits

Sequence:  FBpp0076239
Domain Number - Region: 340-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00209
Family Spermadhesin, CUB domain 0.015
Further Details:      
 
Domain Number - Region: 303-360
Classification Level Classification E-value
Superfamily CcmK-like 0.0497
Family CcmK-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076239   Gene: FBgn0035941   Transcript: FBtr0076512
Sequence length 415
Comment type=protein; loc=3L:join(8952077..8952290,8952898..8953056,8953121..8953995); ID=FBpp0076239; name=CG13313-PA; parent=FBgn0035941,FBtr0076512; dbxref=FlyBase:FBpp0076239,FlyBase_Annotation_IDs:CG13313-PA,GB_protein:AAF50347.2,REFSEQ:NP_648267,GB_protein:AAF50347,FlyMine:FBpp0076239,modMine:FBpp0076239; MD5=f3ee6b9e20e62687ce6e5bdc54331bc2; length=415; release=r5.30; species=Dmel;
Sequence
MSAGGRSSQLLALVVIFFSSYIVGIYSAARASSLALAPLSKANESLILANDTLLAEDGNS
SLVHSGSRHPRWFPFYTIGRFSNDICVGNNLLLGTCVINGECTDNSGVAAGSCSSITAQA
ICCIYQRTCGASTSYNNTYFYNSNYPAPYGGGGRCSIVVTPPDSSICQLRVDFLSLSLAP
PSGDGSCSTDALTITGGASQVPSICGENAGQHVYVDFNGVSPITISVATSGSYTFNRNWQ
FQIRMLGCTSATLAPAGCLQYYMPSSGTLASFNYNSAAASALNSIGVQGTRQLANTKYGI
CIRKAAGMCSITYSQVGSDTYSFTLTNDVGAVDPTLLATSSVQSQECTTDYIIIPSPTQG
GVAMPSDRFCGLGLVSTTTSAKPFVVYTVTDGNEDMDISNRGFYLSYSQNACPIL
Download sequence
Identical sequences Q9VSR6
FBpp0076239 NP_648267.1.81976 7227.FBpp0076239 FBpp0076239 FBpp0076239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]