SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076317 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076317
Domain Number 1 Region: 105-216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000249
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076317   Gene: FBgn0035928   Transcript: FBtr0076590
Sequence length 401
Comment type=protein; loc=3L:complement(8791944..8792062,8792146..8792667,8792871..8793134,8793189..8793341,8793425..8793572); ID=FBpp0076317; name=CG13310-PA; parent=FBgn0035928,FBtr0076590; dbxref=FlyBase:FBpp0076317,FlyBase_Annotation_IDs:CG13310-PA,GB_protein:AAF50364.1,REFSEQ:NP_648257,GB_protein:AAF50364,FlyMine:FBpp0076317,modMine:FBpp0076317; MD5=8ac4212b0f01e64512195494f5bf3a44; length=401; release=r5.30; species=Dmel;
Sequence
MLHLQLTLLSCLLVLANCKIQKQIPTNSWRDMLFGSKWLTPAPRWRESKFLPIFALVPIG
PGSCSAPSGEQGNCIPSKDCVLRNGIPAGPCGGGYGVCCIFLQTCGGIIRENSTYFVNPN
HPDVYDGTGSCQVTVQKLHPDICQLRLDLDMFSIAPPEAANHLCNQDQLLISGGSPTPTI
CGSSTGDHMYIDAGLGQSNPIVLSVITSGSFPRLWRIRVTQIHCGSISRADQGCLQYYTA
ISGRVRSFNYNTVGGRQLSNQDYSICIRNERNFCGIQYNACPDLENNRSRSFTLTGNSNN
PVATMVGGGGGMPPNLNGCTSDWLLIGCIRSADRIPPLPGCEDRVCGGTFSAEAGMLAKT
VQSSVRPFRLYFHTDGVEAPNDIDNRGFCLDYVQQPCTNGF
Download sequence
Identical sequences Q9VSQ2
FBpp0076317 FBpp0076317 FBpp0076317 NP_648257.1.81976 7227.FBpp0076317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]