SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076359 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076359
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.76e-22
Family Ribosomal protein L14e 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076359   Gene: FBgn0017579   Transcript: FBtr0076633
Sequence length 166
Comment type=protein; loc=3L:join(8594135..8594137,8594414..8594515,8594748..8594942,8595203..8595403); ID=FBpp0076359; name=RpL14-PA; parent=FBgn0017579,FBtr0076633; dbxref=FlyBase:FBpp0076359,FlyBase_Annotation_IDs:CG6253-PA,GB_protein:AAF50393.1,REFSEQ:NP_523975,GB_protein:AAF50393,FlyMine:FBpp0076359,modMine:FBpp0076359; MD5=a8770f33c4e9685bb6fcb587b1869f19; length=166; release=r5.30; species=Dmel;
Sequence
MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKY
RIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRN
KLLTIAFNTLKKRTKADGTPRVLKKDRRERLRAEKAKGGKKAAAKK
Download sequence
Identical sequences A0A0J9UHD4 A0A1B2AIV7 P55841
FBpp0076359 NP_523975.1.81976 XP_016031028.1.80810 XP_016992527.1.47939 XP_017026418.1.37106 XP_020816398.1.32911 FBpp0076359 FBpp0076359 4v6w_CM 7227.FBpp0076359 FR406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]