SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076382 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076382
Domain Number 1 Region: 421-630
Classification Level Classification E-value
Superfamily TPR-like 1.9e-33
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 29-134
Classification Level Classification E-value
Superfamily TPR-like 4.8e-33
Family Tetratricopeptide repeat (TPR) 0.0004
Further Details:      
 
Domain Number 3 Region: 803-996
Classification Level Classification E-value
Superfamily TPR-like 5.58e-31
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 
Domain Number 4 Region: 235-435
Classification Level Classification E-value
Superfamily TPR-like 1.24e-30
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Domain Number 5 Region: 642-797
Classification Level Classification E-value
Superfamily TPR-like 1.44e-21
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 6 Region: 964-1113
Classification Level Classification E-value
Superfamily TPR-like 2.91e-16
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 7 Region: 159-274
Classification Level Classification E-value
Superfamily TPR-like 0.000000921
Family Tetratricopeptide repeat (TPR) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076382   Gene: FBgn0035898   Transcript: FBtr0076658
Sequence length 2444
Comment type=protein; loc=3L:complement(8466107..8467842,8467903..8468672,8468735..8470418,8470481..8471648,8471715..8473050,8473162..8473784,8474145..8474162); ID=FBpp0076382; name=CG6915-PA; parent=FBgn0035898,FBtr0076658; dbxref=FlyBase:FBpp0076382,FlyBase_Annotation_IDs:CG6915-PA,GB_protein:AAF50412.1,REFSEQ:NP_648228,GB_protein:AAF50412,FlyMine:FBpp0076382,modMine:FBpp0076382; MD5=997445b239f9cd0466e37f943b5fd4eb; length=2444; release=r5.30; species=Dmel;
Sequence
MQLKPTNEPECTPELPAANRALFLEKVRQSNAACQSGDFATAVLLYTDALQLDPGNHILY
SNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQ
EPSNKQLMAGLVEASLKSPLRAALEPTLQQLRTMQLQESPFVVSSVVGQELLQATQYSAA
VTVLEAALRIGSCSLKLRGSVFSALSSAHWALNHQGAHKEALTAHRYQLVLAMKCKDTQA
AAAALTSLGHVYTASGDYPNALASHKQCVQLFKQLGDRLQEAREIGNVGAVYLALGECEA
ALDCHSQHLRLARKLHDQVEEARAYSNLGSAHHQRRQFTQAAACHEQVLRIAQALGDRSM
EAAAYAGLGHAARCAGDASASKRFHERQLAMALAARDKLGEGRACSNLGIVYQMLGSHDA
ALKLHQAHLGIARSLGDRTGMGKAYGNMARMAHMAGSYEAAVKYHKQELAINQAMNDRSA
EAATHGNLAVAYQALGAHDAALTHYRAHLATARSLKDTAGEACALLNLGNCLSGRQEYEE
AVPHYESYLMLAQELGDVAAEGKACHLLGYAHFSLGNYRAAVRYYDQDLALAKDAQHRPN
MGRAYCNLGLAHLALGHTAAALECQQLFLAVAHATNQLPAKFRALGNIGDILIRTGSHEE
AIKLYQRQLALARAAGDRSMEAAACGALGLAHRLMRRWDKALGHHTQELTLRQELGDLSG
ECRAHGHLGAVHMALCSWTNAVKCYQEQLERAQEQRDAAVEAQAHGNLGIARLNMAHYEA
AIGCLEAQLGTLERVSLPSTQADRARALGHLGDCYAALGDYEEALKCHDRQLQLALGLTS
HRDQERAYRGLGQARRALGQLPAALVCLEKRLVVAHELHSPEIKALAYGDLGHVHAALGN
HAQALNCLEHQRELAQGLQDRALESDAMCALGQVQQRMGQHAQALELHRQDLEICTELSA
PALQARALSNLGSVHESLGQQAEALKCYERQLELSTDRLAKAMACLALGRVHHQLEQHNQ
AVDYLRQGLASAQTTGKSEEEAKIRHQLGLALRSSGDAEGAHIQLETAAQLLESVRHEQR
SPETRQALYDLQTTCYQLLQVLLVALNRNEDALVAAERCKARGGADAVSGEGSKVPLADS
ESIQETVDRGRTTVLYYSLAGDQLFTWLLEPHVGIVRFHAAKIDAHSLQLPLSLSEEEEE
EEDLEMERELKLNRDQNQDQSEDQGTSNKANRLLERYMSLVRDNLGVNSQSLLHEGDGSG
WRASTEQLLEDLPGAGGSGGGGFLRMVSRNQLLNSSNYSLSSLFSVGSVGGSVASLQGST
RSVGSRSSRRAPGLPVWRGPSCLHILYNLLLAPFDDLLPAGEADTNRQGRRELVLVLDSS
LYLVPFAILRAAQEDGEYLCERCAILTAPSLQSMRSRPRIRRDRARPPKALVVGGPRIPS
NLAELWGWAGAESPAALQEAAMVADMLQATALAGSNATKESVLAELPSAECVHFAANISW
QLGAVVLSPGDVVTAEQQEQKEPHEPQMTDFTLAAGELRQLRLSARLVVLSSYHSVEPIT
GDGVAQLAGGWLLAGAGVVLISLWPVPETAAKILLRAFYSALLQGARAARALAEAMQTVQ
HTKHFAHPANWAGFLLVGSNIRLSNKVAMGHALCELLRTPERCRDALRVCLHLVEKSLQR
IHRGQKNAMYTTQQSIENKAGPVAGWKDLLMAVGFRVEPAANGIPASVFFPQADPEERLA
QCSASLQALLALTPATLQALGKLVHVNSAEYAGDIIAVVRNILAQFPGSNPATGSSSTKS
DAIAETCFIEMPLSVRLWRVAGCHELLASVGFDLTEVGADQVILRTGKQANRRQCQFVLQ
ALLALFDTREAPKNLGLDRDSDHSSSCESLAEPEMDVASIPPAASSTPSVNGGNKAPLPL
HPRSAFISYVRRRGEPDGGRTDAIGGVGSGALDSSLANTTDSEHSLSDGYVTQPGFGLSN
PRLGYASMRAPVRVSRPGGGGESDAAFTPSPPVTDPSLSLALAHQTRIRSLYSQTSSAAI
VPPVATTLNRRPDSSSSASSTTDWEGSGHATVLRRGVSTAIPQQQPPLPPPRPPTFHNLS
VGAGGRSKPKIKLGSAQSSLAARVNKEHALFMDRLSVRTELSAPGSGNAMTSGSAARKPL
ALPEEEDVSNVVFNPSSLYFSQTDSDLLNEPKQEETPPPTKSSTKSLQDSMMRHMNRELT
PSISEMYHDRNVGLGLAPPLSKLLLSPNYEEQEVVSITEACPQSGANLKTLVDAVSELEL
SGSSSGATMPTVVGGGANEVEGTSGTSAEATCPICGEPADVICRCKAVTIQKKSILKPWL
SNVPDSSLVQASELTTADILERRLEIHTATSSELRSGAPYSVDLSRRDEGDGRSVADSQC
SSNYKRVLASASGGALSLAGIGKGSEAEAQSASSGATCSSARLV
Download sequence
Identical sequences 7227.FBpp0076382 FBpp0076382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]