SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076384 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076384
Domain Number 1 Region: 181-254
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-17
Family Cold shock DNA-binding domain-like 0.0000926
Further Details:      
 
Domain Number 2 Region: 759-836
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000197
Family Cold shock DNA-binding domain-like 0.0047
Further Details:      
 
Domain Number 3 Region: 505-590
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000309
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 919-990
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000176
Family Cold shock DNA-binding domain-like 0.0029
Further Details:      
 
Domain Number 5 Region: 334-418
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000257
Family Cold shock DNA-binding domain-like 0.0026
Further Details:      
 
Weak hits

Sequence:  FBpp0076384
Domain Number - Region: 286-338
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0793
Family Cold shock DNA-binding domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076384   Gene: FBgn0035895   Transcript: FBtr0076661
Sequence length 1039
Comment type=protein; loc=3L:complement(8427569..8427585,8427650..8427827,8427884..8428831,8428891..8429060,8429122..8429275,8429346..8429810,8429865..8430072,8430139..8430533,8430608..8431155,8431293..8431329); ID=FBpp0076384; name=Unr-PA; parent=FBgn0035895,FBtr0076661; dbxref=FlyBase:FBpp0076384,FlyBase_Annotation_IDs:CG7015-PA,GB_protein:AAF50415.2,REFSEQ:NP_648226,GB_protein:AAF50415,FlyMine:FBpp0076384,modMine:FBpp0076384; MD5=d3b19e906e574ce4e50900e968826c88; length=1039; release=r5.30; species=Dmel;
Sequence
MNTQSKVYRTGEEIYDNLPCDSYFNMNAIRNLGIPTTFPTIGTFTLDSTTLGLQPQGQGP
SPQQQQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQ
QQQQQHPTIGMFDANEVNDVIQNPPQIGVFQSNSVLTNGAGSGSSIFGSQSSNSSAAAAD
PSQTTRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRT
GKPIASQVSKIAPEVVLSEERVTGTVTTELRTDSANNVLNSSETTGRISYENRGECFFLP
YTKDDVEGNVNLRAGDKVSFQIATNQRGNLGACHIRLENPAQPVKYRGVVCSMKESFGFI
ERADVVKEIFFHFSEAEGNVELRPGDDVEFTIQTRSSASVPPQGREFACNITRLAPGSVI
FEDVDSTVYKGQVLKSLDRNNPVRQNNDPLPGRIRYRALDYSEVEVPFGDKDQKGDFTLR
HGDWVQFLLATDRRDQLQRATSIALLDETFKVSGEKREQGTIASLKEGFGFLRCVERQAR
LFFHFTEVLDTSREIDINDEVEFTVIQEPGLAYNNSRLQAIRIKHLPPNSVQFETLVASN
IEGCVTREAPKSPIKSQDRVEGGVITYEHADVKKTIMYFLKDCEKPPRIGERVRFDIYMV
KRNKECIAVNVQQVSLHQQQQQQQQQLHLNQSNAGANINQNDQLGGLSNGISSSSSNASL
QNGYVMHGSPGGSTSSVGSNNPVHLDEFKMENNNHAGSDAGQVYRGFIAVMKENFGFIET
LSHDEEVFFHFSNYMGNPNWLELGQEVEYTLARNGNTSVSGNCLPAENVRMLPKNSIPQP
AVLETTHNGVVARPLRCINPDQQEYAGLIEILDELRTTVISQHEFGITSLVNKRDLLQKG
DLVSFRIDESGRAACVNAVRQKKRATVDSIKGQFGFLNFEVEDGKKLFFHMSEVQGNTVA
LHPGDTVEFSVVTNQRNGKSSACNVLKINDRPDRLISRLKLNGDDTVPRLILIRAPKGPQ
GKGFSVLARHPRIPGNLVE
Download sequence
Identical sequences Q9VSK3
NP_648226.2.81976 FBpp0076384 FBpp0076384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]