SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076399 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076399
Domain Number 1 Region: 200-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000115
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 439-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 311-384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000458
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 
Weak hits

Sequence:  FBpp0076399
Domain Number - Region: 87-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0327
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076399   Gene: FBgn0035880   Transcript: FBtr0076676
Sequence length 684
Comment type=protein; loc=3L:complement(8346538..8347283,8347342..8347710,8348244..8348648,8348712..8349042,8349105..8349308); ID=FBpp0076399; name=CG17352-PC; parent=FBgn0035880,FBtr0076676; dbxref=FlyBase:FBpp0076399,FlyBase_Annotation_IDs:CG17352-PC,GB_protein:AAN12001.1,REFSEQ:NP_648214,GB_protein:AAN12001,FlyMine:FBpp0076399,modMine:FBpp0076399; MD5=23f1e12eadd40324fffd30dfbff5199a; length=684; release=r5.30; species=Dmel;
Sequence
MLAEALGYGYLLAYVICLLCWPGEAYPASSSYRDLDICNHWDGRRHFLELGSPAGEVHAR
NVTTTAYRSSPLVFKNDAVAGDVWYQCSLELVTCAECVIRVAFTYANFSKSCGNTGGKSS
MCPCEHIQFSEPPYDSTISGQEFCGDGKVFRSKTRTLQLKFFYRASNAHVFSLQYFSERN
VRIVSGSPKQSIVGNGSTKSQPQVISTPYFPMAYPRDYGIEHILTCEADNCQVRLDFTDF
QLGLTSTLEIFDSNGQMLDSYTGEHFRPPITVSSGKSLLLQFRGNSATGVGFRAEVSFVS
SKQLKDERLVPYTDCGGMVTGPGGAITMMNMIENATDVRLFDCIWIIKPGNNYMMMKTHI
SLRVDDFYGMAARSELTIRQGTTSDAVEIENVMWPNNGLSKESHVAPILNGYYIRLRGVF
GMSSKLAIVYSVFNYLNCYIGSEFLCGNNHCISIRLHCDGFDHCGDGSDEPDSCEEDWAH
LHHDRRWYSHKPNYYFPKIDQYPDLKTATGIFIISTLGIFGVLSGWMVILYRMGVRARHQ
RELQSHLQTISELLDRQDEDRTPDEPPSYEAPPDYEEVIKVGMQQELREPRRQRRARRAP
PRDRSCSRAASNCTVQSVLPLHRSCTLERDQEQPSTSAAAMTHAVAATDTTEDAEHVQTM
AQRMLLATAICGRSRVPPIPPCSR
Download sequence
Identical sequences Q8IQA8
FBpp0076399 FBpp0076399 NP_648214.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]