SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076600 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076600
Domain Number 1 Region: 645-848
Classification Level Classification E-value
Superfamily TPR-like 1.77e-40
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 
Domain Number 2 Region: 35-155,532-608
Classification Level Classification E-value
Superfamily TPR-like 1.1e-21
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076600   Gene: FBgn0012058   Transcript: FBtr0076890
Sequence length 900
Comment type=protein; loc=3L:complement(7238932..7241534,7241604..7241679,7241758..7241781); ID=FBpp0076600; name=Cdc27-PA; parent=FBgn0012058,FBtr0076890; dbxref=FlyBase:FBpp0076600,FlyBase_Annotation_IDs:CG8610-PA,GB_protein:AAF50592.1,REFSEQ:NP_648093,GB_protein:AAF50592,FlyMine:FBpp0076600,modMine:FBpp0076600; MD5=ce4256ae043db2a964c7612257717f9e; length=900; release=r5.30; species=Dmel;
Sequence
MMIQEPVQAAIWHCLNYYDFKDAVFLSERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESALISTGFADAKNCDELQRDFGDLACFAYQLM
AQICMRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAAAIFQIHSTDVFNTCQG
SSVNANAMVLFGAEQQGQQHQERQSLITNLSNVSNYILTTPVDQQQQQINQNQNQHHNSN
MVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGAPQDPAGQYQQNQQLYDMS
SGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNISYSPMPQMLVEV
NQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMNVPPNP
NAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKAKSRMTKICLNNELIEDKSHH
LSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQSADGLM
ALLRGLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAVAIF
ETIHKTEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWCVSGNCFSLQKE
HETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRDPRHYNAWYGIG
TIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAATLDPKN
PLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLALMHFSW
ATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGSYDSDY
Download sequence
Identical sequences Q9VS37
7227.FBpp0076600 FBpp0076600 FBpp0305561 NP_001261503.1.81976 NP_648093.2.81976 FBpp0076600 FBpp0076600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]