SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076798 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076798
Domain Number 1 Region: 38-102
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-19
Family Cold shock DNA-binding domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 115-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000123
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076798   Gene: FBgn0035626   Transcript: FBtr0077090
Sequence length 195
Comment type=protein; loc=3L:join(5648080..5648146,5649419..5649555,5649705..5649853,5649923..5650073,5650136..5650219); ID=FBpp0076798; name=lin-28-PA; parent=FBgn0035626,FBtr0077090; dbxref=FlyBase:FBpp0076798,FlyBase_Annotation_IDs:CG17334-PA,GB_protein:AAF50758.2,REFSEQ:NP_647983,GB_protein:AAF50758,FlyMine:FBpp0076798,modMine:FBpp0076798; MD5=d528927037520fdcc75a3f350aee3d3b; length=195; release=r5.30; species=Dmel;
Sequence
MENVQLENGLERRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDG
GQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINR
RTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISN
NSSSSAAQEKSEEAT
Download sequence
Identical sequences Q9VRN5
7227.FBpp0076798 NP_647983.1.81976 FBpp0076798 FBpp0076798 FBpp0076798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]