SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076804 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076804
Domain Number 1 Region: 117-266
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-44
Family Hypothetical protein AT3g04780/F7O18 27 0.0000897
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-30
Family Thioltransferase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076804   Gene: FBgn0035631   Transcript: FBtr0077098
Sequence length 287
Comment type=protein; loc=3L:join(5759110..5759475,5759533..5759816,5759876..5760089); ID=FBpp0076804; name=Txl-PA; parent=FBgn0035631,FBtr0077098; dbxref=FlyBase:FBpp0076804,FlyBase_Annotation_IDs:CG5495-PA,GB_protein:AAF50750.1,REFSEQ:NP_523938,GB_protein:AAF50750,FlyMine:FBpp0076804,modMine:FBpp0076804; MD5=74cebe615f2db8c8ff476e45b5cdf76c; length=287; release=r5.30; species=Dmel;
Sequence
MSVRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDV
DKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDYGQ
GLMELNTFISKQECECLNEADDHNLKHALASAGGYLQSDCDEQLILSITFNQAVKIHSLK
FKAPSHLGPKDVKLFINQPRTIDFDMAESMNSVQDLSLAQKELESGVPVNLRYVKFQNVQ
NIQIFVKNNQSGGDVTQIDYIGFIGSPIMTTKMNDFKRVAGKKGESH
Download sequence
Identical sequences Q9VRP3
NP_523938.2.81976 FBpp0076804 FBpp0076804 7227.FBpp0076804 FBpp0076804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]