SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077004 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077004
Domain Number 1 Region: 306-593
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-61
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 32-142
Classification Level Classification E-value
Superfamily POZ domain 1.14e-30
Family BTB/POZ domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077004   Gene: FBgn0031119   Transcript: FBtr0077312
Sequence length 616
Comment type=protein; loc=X:join(20382935..20383114,20383929..20384778,20384858..20385217,20385381..20385841); ID=FBpp0077004; name=CG1812-PA; parent=FBgn0031119,FBtr0077312; dbxref=FlyBase:FBpp0077004,FlyBase_Annotation_IDs:CG1812-PA,GB_protein:AAF50896.1,REFSEQ:NP_608397,GB_protein:AAF50896,FlyMine:FBpp0077004,modMine:FBpp0077004; MD5=12edf371a192c4d6b09ad6f3c5c0175f; length=616; release=r5.30; species=Dmel;
Sequence
MAATPAPAVTPAATATSAAAKIPVNPVSPEEETLLRGLNKLRNEEKLTDVTLIVEEHRFK
AHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYTSMLELNYDNIE
EILAAATHVQVREVIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEE
FATTSDFKEMKVDQLRFILSSNYPIDVAEQDLVRLVCSFAIEQQLNESALGDLLRLIKWQ
HISYKSVDELRNMNCSLDKGKQLPLPTSYYNRIKQEHMGHLLNGVVSLKDQSLPQGPTNM
RGMELCLLKIGGFEWNGLTNVIMCFSPKKMNWYELTAIPHIDQCNFGTAVLNNKLFIVGG
AYDVFLKEYIHPFGFCYCPLRNTWMTIAPIQQDRCRFSLNAVGTQHLYAVGGILDDDNEE
ALRMISNVERYDIAKNVWTYMPSLQENRSQHAGVVVGDKLYISGGVHLANILASMWVFDT
KTEVWQELASMPTPCCDHVLVAVDNRIYACGGWHESLTEWRVLVEHIYAYDIETNTWSVE
TKIPAPKFYTGVTAMGRTIFFVGGLDSTESIDRASAETMAYDLDTKEWWHEKDSWDSPND
VWESTCVAIYVPNCDA
Download sequence
Identical sequences Q9VRA7
FBpp0077004 FBpp0077005 7227.FBpp0077004 FBpp0077004 NP_608397.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]