SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077080 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0077080
Domain Number - Region: 429-527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000216
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077080   Gene: FBgn0051660   Transcript: FBtr0077388
Sequence length 790
Comment type=protein; loc=2L:join(4865303..4866130,4870478..4870717,4870778..4870836,4871076..4871195,4871258..4871338,4871416..4871764,4871825..4871893,4871955..4872356,4872499..4872693,4873596..4873625); ID=FBpp0077080; name=pog-PB; parent=FBgn0051660,FBtr0077388; dbxref=GB_protein:AAF50967.2,FlyBase:FBpp0077080,FlyBase_Annotation_IDs:CG31660-PB,GB_protein:AAF50967.3,REFSEQ:NP_723019,GB_protein:AAF50967,FlyMine:FBpp0077080,modMine:FBpp0077080; MD5=8f95a96c46934552f44a308682aee668; length=790; release=r5.30; species=Dmel;
Sequence
MELCIATKSKIETAQSSMPQSSQCSSSSNCRNYQKKCHQNQTNTQVQSTQRSNCSSHSDR
DHLTNQQKQQNQRTNSATAASAAAATLSESTRCNIIISSSSSSSSSTKSSKNIREPSSSS
STQLNTLYSLLVLLIVGLATATASPSPSPSHAPFGRESRRDALLAYYKRAHLPQSSSSGI
SLGHKYHLLHDANGLDFDELTPTASSVSALSRAERFRLRKRSATPTTPATAAGVTSLDVA
TAAAAATDAAAKDAGSGKKPEEKCEPKVLETLPDEPFYDYTDIAEDAARQFIEFLSGKFP
NANTPIAIDEPTRAEVSRRANGIASYALNEDDNLLAFAIAAPSIHTVVVKFRDNVTIPPD
QVHNKAYLGSYWRELGAAWNSTDGTQEWGAPFRDCNLLTRRWLWPFRISFSEHRIKVVAA
AFIAADEDVCNDGLEEVFGRRHGCDRNTTFCLLTENKPAATRDVYTCLCRESYYLPNSTL
QGFRGDRVELSEGYDNYSCIPCPGGCTNCDSNGVCLTFQEEEVLNVDACLRLLVAIVLGA
CILCCIVLGVIVFRQRKCKAIASGMWTVLETILLGIVLLYASVAVHFFPASTERCLLEPW
LRELGFITCYGAIILKLYRHLVDFRTRKAHRWVLRDVDLLKYLGTMVFAVICYMAAFTAS
SLDLLESAQLESLREADTNTCHPLKWELVTQTSEMLILCFGLHLSIASRNANTQFRERQF
LVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWYQHK
QHPQRYNHDQ
Download sequence
Identical sequences Q9VR40
FBpp0077080 FBpp0077080 NP_723019.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]