SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077141 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077141
Domain Number 1 Region: 22-104
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.58e-23
Family Ribosomal L27 protein 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077141   Gene: FBgn0053002   Transcript: FBtr0077451
Sequence length 138
Comment type=protein; loc=2L:complement(4459004..4459207,4459266..4459429,4459484..4459532); ID=FBpp0077141; name=mRpL27-PA; parent=FBgn0053002,FBtr0077451; dbxref=FlyBase:FBpp0077141,FlyBase_Annotation_IDs:CG33002-PA,GB_protein:AAO41158.1,REFSEQ:NP_787971,GB_protein:AAO41158,FlyMine:FBpp0077141,modMine:FBpp0077141; MD5=1f381f901f95e70a7159c3390c0ead71; length=138; release=r5.30; species=Dmel;
Sequence
MQKLTMQCLKADQPLMTTVRNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILAT
QLTTRFHPGLNVGFGRNGTLFAMEHGKVYVTCEAIDPNWDHTWIQRNYAGRQGQNIYKKF
FNVVPENQHQRFRLVEEI
Download sequence
Identical sequences Q86BM8
FBpp0077141 7227.FBpp0077141 FBpp0077141 FBpp0077141 NP_001260028.1.81976 NP_001285602.1.81976 NP_787971.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]