SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077185 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077185
Domain Number 1 Region: 1068-1179
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00097
Further Details:      
 
Domain Number 2 Region: 189-297
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 2582-2693
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000385
Family C-type lectin domain 0.017
Further Details:      
 
Domain Number 4 Region: 1931-2040
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000085
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0076
Further Details:      
 
Domain Number 5 Region: 975-1003,1031-1055,1179-1293,1550-1656
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000318
Family Galacturonase 0.065
Further Details:      
 
Domain Number 6 Region: 469-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000149
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 7 Region: 349-427,555-713
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000224
Family Galacturonase 0.069
Further Details:      
 
Weak hits

Sequence:  FBpp0077185
Domain Number - Region: 2330-2559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0173
Family Pectate lyase-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077185   Gene: FBgn0031571   Transcript: FBtr0077496
Sequence length 3115
Comment type=protein; loc=2L:join(3790663..3791145,3792596..3792774,3792833..3796886,3796949..3799154,3799217..3799428,3799498..3799853,3799912..3800037,3800290..3800387,3800451..3800821,3800880..3801104,3801208..3802245); ID=FBpp0077185; name=CG3921-PA; parent=FBgn0031571,FBtr0077496; dbxref=FlyBase:FBpp0077185,FlyBase_Annotation_IDs:CG3921-PA,GB_protein:AAF51061.1,REFSEQ:NP_608808,GB_protein:AAF51061,FlyMine:FBpp0077185,modMine:FBpp0077185; MD5=44888c43edaa7d91fb1fade0f74d4321; length=3115; release=r5.30; species=Dmel;
Sequence
MKLQHHKTNRQRISKPHRDPKWASICLWLLVTLAFSTHLARSQESRQTEDSKEVELLQDN
DIEFASLDGASQLLPATRHSGADVTVAPQGSTPSMTSSSSYTELQGGEILSDRILRRSES
PYLARDDIEVLRGARLTIEPGVTIEFAPTKGLKINGVLQAVGTPTSRIVLKSQSNTANYK
LELPDDQEKGIRLVDGPTPVEGRLQLFHKGAWRSVCSNSRNWTLADYGVACKQLGYRGGR
FWNWVERTPGYYPRLLYEQPKCKGGEGSLQDCAWTSRQMGAGACDYHNDLGIQCLPVHSE
TLGHWRGIYFDNAPSTKALGRDNIVYAAQSESRLKYVDIIRAGSGAGFNAKSAVEVQGLP
PQMEHVVISHSAYTGFNSTRPWAGFQLQNVTVRKCNGIGVFVNSSQGAVQLDGCSIVDNA
GDGIKYVGHDLRGTERKDRASIYDFCTLPTTSGQTYPISLSFTQKYYAGSGKECGKYFFT
RPGYLLTLHFENFVLMQNETATVEIYDGASTNDRLLFEWKARNFTRPQSVTSTREKMFVR
IRADARQELNGFFRMTSGDSVAYDLKVSQSTVEDNGGRGVAIDNIRSKLHVHSSSVSGNG
HVAGVHVTSGAGDVNITSSNISFNNGAGVNITYYGGNRNISRSALTANKGYGVATWLNQT
SDVNRMEYIPFNQTSVVEYSQIGGNLETGVFHGNFCRPIWVNITGNSFNGSQQNDIFIES
CYQATANGRPNMQLQLGHNQFKYSQANSIYLSPALNLQGRIEYNMFRFGSYGCLFINNDY
IYPEFNYFPVKLIIQSNYFMRNSGVHVVSLGLSPYSRAEVQYILFTRNFVRGNNITEAFG
PLIAGSEGSDGAGRLNPRSRVAAPVVVGSSNVDIFRNILHNLDSMYEIGSQLTDQSKIIN
ATCNWLGHTDENKIYARLFHRNDRYNLAKINYLPYLLHSSNPGSTAMITVSTVVPRFFHE
GSDVIGGEVDGQDMVPAGTYTVTKDINIRPGGKLILQPGTTLKFEPSVGMMVAGKLEARG
RRPDDILFTLKRETIMGESNDTETIDLDSETEAIDMETEVIPADGVPRVPVRLVGGAGAN
EGRLQVYLKGRWGTVCDYGWNVLNAALVCHQLGYSLNPQDWRLLRSQLPNAGTSEDILMA
NVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRCYEGAWAGVRFSMLAERADLQYVTVEK
AGLFDYTTNAFKPAVQMDHARHNLENVRIVNNLQDGLGIIYADIYAGKSVNNIKNSEFSG
NKGSGISLKQLDFRVSGSIIKDNKGSGVSHDAVISALDQKEIGGWFNMATDFNSFDTDYD
PYLLPREISNIDLGTFEHKYIRTEELLGQNINRKIVVQCPAGYVIGIQLLNPIHNLSTES
INILNARTENIRSDLWQVKRDLNVFPVTSSSYGIIIYYESGLQALGGAVLMLSTVTAPVQ
NIRNRIVSGAVPTLTIRSTKIQKNLRGITGIYYNRYIGDNGEYYLRKANESIKLINSELS
YNEREAILIRSPFWDVISSNLSEVTLHVNGSLITQNGLGIRQMSKDLRSSNNLFHYVIQD
TTFEQNTHGGFQVSLPYVWQYNENFTHSIYFGNSTWQRNRDFRISVSGHYTVFNITSNVF
RENNCPGALISLDGMEKRLRFDNNRFESNNAKFVLLFKADSLSEIIGQVPASIEFNSFKG
NNIVTMTANYRNHYMKVARRIRKQHKIPTAVIRLDGVQNVRLYRNLIAENEMDYNLVAGV
RSARLNNYFEARENWWGTKDTAFIEAKIFDFDNWNDHADVIYQPFLIEDSYDASVSVVVP
FNQDQEIDLTNYKGGRVYKDLLLTKQSTPYYISSDITVMPGKTLTINHGVTMEFEPNVGI
LVLGTLVAIGYRESPIVMRPFRNATRESLIDVQPKKRALEDMSAPLTEFDSIRLCTSANN
CTGDADGLFGLNEGFLEYFNHTTLQWVPICDSRFTERNAQVVCRELGYDPLNVYYGHDRR
IEFHTNSLTRIWSWVQPLECRGDEERMEDCAERLNGQLYGHRHECRWDDVFVFVSCNGIA
DDEVYWGGIRFANSKFEEIQYEHRLHNTRSHARLPLRESQLEFVRIEQAGILHNHKAAAI
QAIHKNPSITSVSIENSANHGINMIAPSGKLNLNHLNINNTLGTGISIVSLSGEGRDSDE
SSFTPLKKLDLPYKLFSLVDICDPQKVLTIEERMLIYYKYDNNPVNCVKIFTSAFRAKPI
GFRLLQSNLFNHSKLYGRTDFIKLYDGDIYNVTATYLGKIESDTDNQRSFFKTKGPTMSL
QLVASGAPETHGFIAEVVTVPISTLGQYRDALHNITDTHISGAIKGAVTYSSAGEVTPTL
TLIGNRIEKNCRQLYGNFSTCTSALNLDVQNMNSLYFMNNLITENQGGLRIRADSRGSAT
SLRGFVHHNLFMRNRNRPALYVEGRQSSPYQEVELYRNYFAQNMAGYEDVIRLCQVVSNF
SYNYVHSNVGGRIMEVSGFEKVRLQIYQTTAHNGFYRNFATNWMTRATIVAGTAGQQYVD
NIFENHENDYELLTVNNSMTFETWSSKIDARHNYWSYNNTISVQSRIRDKSDDPMLLEVL
AVPFQMNNETILDGKCPPGWALVHDTCFIYVGAPMTFHEARDFCRSENSTMPFIRTDKTT
LWKYLQSQMRHLKYPDKVWIQDYNHIDRCTSFVFGEIEIEDCNKERGFICESDPRVIIDP
LSWRADIFAISIISAFVLAIILLILVAFCWFAKSKHRHTQRLQRRNSIRQSLRSLNSIDP
QGSLRRRPNYNMSSNGTLSKGQDYKQMVANGSIDSMDKSVLSSEAGSFEGYEQKPHYNEY
VNQNALRPAHPAQDHQSHKVATISKASGHRARAAAAAAAALEPDAFELSYRNEGFRDNST
YGDNTRANSISTSVAEDTPIIHHTDQEIDEGGSDYYGNASTLPLRTEGGTPAGRRGQPGL
AFLSELKQNLPEYQRSSHSSFMPHRSSGDSLPFDQKLDQFNYSTESSLYRPAPAVPSSQQ
ATPADMRRPDSYYTAVRSSKAPVSHYRTPRPLAQPPAAPNVAPAGGPAQRRPKTVYQTAS
EESSPTTPSPLTNQYHRSKSEALLETDFDGDGGSVGLQPLQTNGRSHSQPLETAM
Download sequence
Identical sequences NP_608808.1.81976 FBpp0077185 FBpp0077185 7227.FBpp0077185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]