SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077619 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077619
Domain Number 1 Region: 841-967
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000868
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 602-720,831-899
Classification Level Classification E-value
Superfamily HCP-like 0.000000152
Family HCP-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077619   Gene: FBgn0031301   Transcript: FBtr0077954
Sequence length 1017
Comment type=protein; loc=2L:join(1108701..1109895,1109963..1110423,1110480..1110674,1111264..1111397,1111454..1111967,1112028..1112444,1112506..1112643); ID=FBpp0077619; name=CG14339-PA; parent=FBgn0031301,FBtr0077954; dbxref=FlyBase:FBpp0077619,FlyBase_Annotation_IDs:CG14339-PA,GB_protein:AAF51420.1,REFSEQ:NP_608566,GB_protein:AAF51420,FlyMine:FBpp0077619,modMine:FBpp0077619; MD5=b42612389567896c0726befbd3466376; length=1017; release=r5.30; species=Dmel;
Sequence
MPPKKAKKGAGPKKDDDLDNRPQPPNVFLYIQLANIVNMPESQHPLEIHISQGDSLLVKC
DEHYNTDGIIVQEEFHSKPTFTLIFQQDNVDRINHAADNPLLVQLYMRVLPPRRIVQVEY
EMLEEEQEGDLEADSDSDLTMSTTIATTLLDDDAFEARETVKLELLCVGYLDVIKLFGHR
RSMICEELFLYPMPDVPNEMRSTIHTEWHLYTLLPIAKKLTFTNMAFVTFESIYCLKDEY
VLDLETLWVRVSFRSRMPGDRNESLIPLCEFGNLERKIICMQDNHHVFESFRRSVKPWNV
TGLKSAMEVQRHRLFSELFHSENLTPDFEEIDPAMDEALVCNSFHRFILTQSMADILSFA
ITCQQYVLAVEVFQTFGAAKPQKVFQGVLDPSIMAYPGVQNMRFAVQLDYLGKLKPKKIM
STFNLKSMERAKTLPTFAIIKLCLLAPIGEIYKELKVFRESFIRQNRLLFCDRPYSSINA
MSLAEIQMECYARFDKFIRDCISFIIDKKVMKLEDKKQHFCCAVQNLTNILMKVVGSVYN
TRTPTNTSVDFANLCAFAYNELEPRVHTVVEQIENEGFDSYTISKQIQNERIIDYLNTIK
LLLMVNDENHAHLLMEKAITEYPSNERFWFYMVIAYMERGELEKAKVYFKKNHLADTHDY
FAGWIKLYINYVDTRNNPETAPDCTECLLRSITNYAERYPRQQDAWILLYCYYKRFNYEP
GCAFALWRFGDQHGHCRLSSSSNAPHSLWGLYVNLNITIPTSRGTMFLEVFRTFARLGLY
EFAQVVIAAVLPLASDADRYMLQTQLDMMLNQLDENFVPLSFEFEEGEEGDYSAAMNAQI
NGNVEFQRGNLEEAALYYESALTLPPPEVNERDFFEVSRLRLGYISYELGNYNKCIEALS
FPFAGQLLSIVANYMIGKSYYKLDLLDLALESFANATHMDTHVPNVWGFLALINLRLGEN
YKAIECWKYAKIEPNYPIDDMMIYEELDAIDYDSVDLYIDAPNQMVDDIFRDSQSDS
Download sequence
Identical sequences Q9VPW5
FBpp0077619 FBpp0077619 FBpp0077619 NP_608566.1.81976 7227.FBpp0077619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]