SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077645 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077645
Domain Number 1 Region: 6-304
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.88e-54
Family WD40-repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  FBpp0077645
Domain Number - Region: 560-750
Classification Level Classification E-value
Superfamily ARM repeat 0.000345
Family Diap1 N-terninal region-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077645   Gene: FBgn0024314   Transcript: FBtr0077980
Sequence length 787
Comment type=protein; loc=2L:complement(1167243..1167954,1168012..1168638,1168695..1169561,1169628..1169785); ID=FBpp0077645; name=Plap-PA; parent=FBgn0024314,FBtr0077980; dbxref=FlyBase:FBpp0077645,FlyBase_Annotation_IDs:CG5105-PA,GB_protein:AAF51402.1,REFSEQ:NP_524666,GB_protein:AAF51402,FlyMine:FBpp0077645,modMine:FBpp0077645; MD5=9c660ee7c1bec2534a2b274ae1c494f1; length=787; release=r5.30; species=Dmel;
Sequence
MEPSLDNYKLSCELLGHSMDVRAVAVGPPTPEGRQTILSGSRDKSTKVWKPHGNEYLESL
TLQDHKNFISYICFLESERWICTASNDATICIYKQDGFVPLLTLKGHESTVCALSAGLEP
RSLISGSWDKTARVWTISEAGDVSFVALEGHEAAVWAVATLKEQRKYVTGGADRNIYYWN
AKGEKLRLLKGHTDCVRGVMGLDANTLLSCGNDAVLRFWNEDGECVREMNGHSNYIYSMA
RNEALGDQVVVSCGEDSTLRMWNVITGDELGAPIIHPGISVWSVTCLQNGDIVTGCSDGV
VRVFSHVPARQASEAVLKAFDLVVATRKSQINEEIGGVKKTDLPGPEALLSNGTREGQTK
MVRHADGSVKCYTWTLGNWNLVGDVTGATGGTQSNSGKKLHEGKEYDFVFSVDISDTEPP
IKLPYNRSDDPWQAAQTFIHRHSLPQAYLDQVANFIIKNSEGPVLMEQAPTGYQDPFTGG
SRYVPGSSNTNMGSGGNVDPFTGASSYSTASSNAQSQVDVNFVRSGDKHFPVSNYRIFDT
CDAKKVLEKMIEFNGKLSLPDGRVGEEVLLAVIKLADQSPELDLTSLEALAILLKWPASM
QFPVLDILRLAVRNEAIFSVLNNSHNFLATVIPQLSGSAPNQLMVVRCLANIMSHAAGRQ
NVMSRLAEIIDLVGAIKTGSANLQIAVATFYLNLTISQTLDVAKSEVCHVVTSGIVELLK
WAKDLEACYRSMQAIGNLTTTSCGQETIAQVVSVDYVMDKLRELTITPQDKNFSKVNSVG
QALLAVF
Download sequence
Identical sequences Q9VPY2
FBpp0077645 FBpp0293253 FBpp0077645 7227.FBpp0077645 NP_001245829.1.81976 NP_001285557.1.81976 NP_524666.2.81976 FR737 FBpp0077645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]