SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077926 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077926
Domain Number 1 Region: 504-549,589-646
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000654
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 2 Region: 213-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 252-377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000251
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 
Domain Number 4 Region: 1199-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000406
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  FBpp0077926
Domain Number - Region: 928-1027
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000432
Family Spermadhesin, CUB domain 0.022
Further Details:      
 
Domain Number - Region: 406-504
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00889
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077926   Gene: FBgn0052432   Transcript: FBtr0078268
Sequence length 1307
Comment type=protein; loc=3L:complement(20837619..20837648,20839029..20839122,20839190..20839391,20839449..20839655,20839712..20839895,20839954..20840220,20840278..20840611,20840665..20840880,20840936..20841345,20841423..20841614,20844513..20844542,20845679..20845861,20847157..20847287,20847705..20847968,20848037..20848140,20848204..20848391,20849526..20849662,20852780..20853526,20874730..20874733); ID=FBpp0077926; name=CG32432-PA; parent=FBgn0052432,FBtr0078268; dbxref=FlyBase:FBpp0077926,FlyBase_Annotation_IDs:CG32432-PA,GB_protein:AAF51654.2,REFSEQ:NP_649266,GB_protein:AAF51654,FlyMine:FBpp0077926,modMine:FBpp0077926; MD5=1bb735f8a7f69b90b196719b72665831; length=1307; release=r5.30; species=Dmel;
Sequence
MNTTVMTLKWRQKYKSRKRPKKLRQRIFATNTAPAKATTTPNHKATTKATSRLRETRCKL
RRHNKCLPSEQHRNVAKMRLKVSTSATQCRAIKATETPATSKMTSSCSGHCQSQQQQQQQ
QHQLQQQHQQSQHQQRRHPLPATLTLLLCLGISLGMAATAAAAGGGGGGGGGAAPVSGSG
AAGFPSSSSSISSSLGPGKPVNLQLAPGSSSTGCSLAEFSCSNGRCVPLSKYCNNLNDCG
DGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRVPFVCVLTFTAAGGQHGDVVQVTLD
SFTIGRFTSYVHEGCPDGYMQIAESARTPIGGMWCGSSWGPVLFYSETRSLIFTIRLNRL
ARDQSGYNFDFRIRYKVLSRDSSVTRYGGIKLAELAQWHNRSSFLNQQQQQQQQQQQQQQ
QQQGAPGILEDFTNSSVARSDRYGQDFSLFSAYANNKTFMASLEKSLAKDEQNYTEPKYY
LGDLIPGTYCSRIFSDCDKKPCRLQSPNFPGIYPRNLTCYYAVRQHDVPHGKHALILVKQ
PKGNLVWISTQETAAANKMAPPPSASDKDKKFEPRLKTWNYCDYIQENVKPKWKSTDYVT
VYDGYTTRDPIILKFCGGGQAVPAAVSSGPELLVEFSTSPFGTFTGTSSQVLPLYGFQLE
VEVQFVDIQSPTYSKNKKPCEFWIRGAGRGILESPKHSLAPNSTCLYHLQGLGVFKTFDH
LSLSRRTSSQSGMHQPLSRFKVWISVLKFNLDPEFGQIDETSVGAIGVLQTQEDCSGMLR
IWDGTLRDAPVCKDLNCATETSSYNTLGHYTHNSTSVIARFCRGTIPRTCDRSNINETYA
RPCTISESYVSTSDAITLELRNTESTVLRPLDFKLKYEFIDLHQDGLPWGGGEHDCNRKF
LSSMMDRKDPAIFRSVRNIFLFGRGGTRNLKCIYKFEAQRGERVRIKMRKVTTTNRPCYS
RVDEDINRSFCYGDTNVRIEIFERPYHDSILLHRGCMCNSSNQSHLPVEYTSTSRDVEVH
FIAQNMTTLDDPDTVNFEGMFEFVKAPTSCKDGRRKFGPSGTIDMTFGDVECRSRPWLIE
PSNGNKFLYVRLKAIFLSKHNPTQTLNATYVQTDTWRCETKSRAVLTTSEGLTIVACPLS
PDSNAYEFVEIFSSGWNERPNFALVNRSRAISVEFLRPGNGEYSFNWMELIPRPTLSMAE
DCQFKCAELGACVNASVWCDGVVHCPSGDDETFLQCSALMKLPAEILATLCLIFVLSCCA
FAAFAYKKIKRKLRGSSVLQTRLKSLSSMDTAVLDEKEKKPVVETKI
Download sequence
Identical sequences Q9VPA1
FBpp0077926 FBpp0077926 FBpp0077926 NP_649266.1.81976 7227.FBpp0077926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]