The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0078038 |
| Domain Number 1 |
Region: 208-272 |
| Classification Level |
Classification |
E-value |
| Superfamily |
RING/U-box |
0.000000000000442 |
| Family |
RING finger domain, C3HC4 |
0.028 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 18-42 |
| Classification Level |
Classification |
E-value |
| Superfamily |
CCCH zinc finger |
0.000000589 |
| Family |
CCCH zinc finger |
0.0044 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Molecular Function |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0078038 Gene: FBgn0029152 Transcript: FBtr0078383 |
| Sequence length |
386 |
| Comment |
type=protein; loc=3L:complement(21524569..21524673,21524858..21525131,21525439..21526220); ID=FBpp0078038; name=Mkrn1-PA; parent=FBgn0029152,FBtr0078383; dbxref=FlyBase:FBpp0078038,FlyBase_Annotation_IDs:CG7184-PA,GB_protein:AAF51740.2,REFSEQ:NP_524704,GB_protein:AAF51740,FlyMine:FBpp0078038,modMine:FBpp0078038; MD5=dfc13da33d87c9d0d8e42a521c421074; length=386; release=r5.30; species=Dmel; |
| Sequence |
MSAVTSSDTAISGMALGRSQTICRYYVRGICRFGELCRFSHDLSRGRPECEEQVATDVLP
KPSTSSSSTIGSRSASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVMEAQAG
ASYDTLAPGVSWAEVVGGPSSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPT
DQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHI
FCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAALGAK
DCKYFKKGEGKCPFGNKCFYKHALPNGDIVDVGLPKRTRKLQSQNEIIDLLDIYLWDYVD
RRDYHWLEMISSDITSSESSDYSDED
|
| Download sequence |
 |
| Identical sequences |
Q9VP20
7227.FBpp0078039 FBpp0078038 FBpp0078038 FBpp0078039 FBpp0293874 NP_001246867.1.81976 NP_524704.1.81976 NP_730653.1.81976 FBpp0078038 FBpp0078039 |
