SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078189 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0078189
Domain Number - Region: 36-103
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00789
Family ComEA-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078189   Gene: FBgn0037184   Transcript: FBtr0078537
Sequence length 372
Comment type=protein; loc=3L:complement(22719644..22720577,22720632..22720816); ID=FBpp0078189; name=CG14450-PA; parent=FBgn0037184,FBtr0078537; dbxref=FlyBase:FBpp0078189,FlyBase_Annotation_IDs:CG14450-PA,GB_protein:AAF51853.1,REFSEQ:NP_649411,GB_protein:AAF51853,FlyMine:FBpp0078189,modMine:FBpp0078189; MD5=df5af4754f8be53f8d38e6bd73cebce5; length=372; release=r5.30; species=Dmel;
Sequence
MLCRRSLLGVTTKCLRLSSTQQHRSGQPECDQAIGLLPAYSDADRLKILKTINESSMNQI
ANYDITKARATKLQNWKNRHGPLQELSDILYVEGFGLKVTTKFFKSLLAPPSSGSAQVGE
NRPKTARVAPFITPAMDEGQRSRIVSAVGVRIGVTSVSWARLKIGSNEAPCLLTHWQHHE
LNDKKLHLSELSRRCLYVSHQIPVADCYVMESPQMAQASSNPGSIDQQNVNIQKAQVSAI
MSFSLMARSDGDENKTNNVYYMRRFLSARLFNHMVGTERVSSEDTILAMMRTHYNVEHQI
PETEPPLKLHKQIDFPADLRLEFSQQERYQRELLGQALLLSLAFTRLVLQQDPQSIASVS
RNSKNSSPSRAT
Download sequence
Identical sequences Q9VNR9
NP_649411.1.81976 FBpp0078189 7227.FBpp0078189 FBpp0078189 FBpp0078189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]