SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078401 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078401
Domain Number 1 Region: 240-294
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.48e-16
Family PHD domain 0.0023
Further Details:      
 
Domain Number 2 Region: 154-202
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000848
Family RING finger domain, C3HC4 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078401   Gene: FBgn0037344   Transcript: FBtr0078752
Sequence length 2296
Comment type=protein; loc=3R:complement(1405866..1406027,1406104..1406232,1406295..1406362,1406446..1410400,1410894..1413173,1413243..1413539); ID=FBpp0078401; name=CG2926-PA; parent=FBgn0037344,FBtr0078752; dbxref=FlyBase:FBpp0078401,FlyBase_Annotation_IDs:CG2926-PA,GB_protein:AAF52001.1,REFSEQ:NP_649554,GB_protein:AAF52001,FlyMine:FBpp0078401,modMine:FBpp0078401; MD5=49105e1385a64ee047fa2a4c49a1004c; length=2296; release=r5.30; species=Dmel;
Sequence
MSDRDSDAVSDAGPRLSQQRGQRNRRIIMRIEFKDSEDSASDQDRDDRPSCSAATRLRRS
TRRQEVASHSDSDSVPRKSTRKLRNRYGPRSDCSSSGSDIDQLPTRTRKRKKVESSDEEE
PERTPNAVGRIQPMPADPDDGFSSDISSNDLLEKCPICLLTFRQQEIGTPATCEHIFCAA
CIDAWSRNVQTCPIDRIEFDRIIVRDSYASRRVVREVRLDLSKSNTELVVDDEADTAALS
EEEVTNCEICESPDREDVMLLCDSCNQGYHMDCLDPPLYEIPAGSWYCDNCIDSDDEDDN
EQLELADDLDQLYEDIRGMGLPETRLRVREVQEPPRILRTRQNERIRAAVLRRTRSGATS
AEDSTLTRTRTRTTTTTTTTTTTTRRTTTSTKKRPVQRRRRRRTRYRTYVVEYDLNNFDE
KFALKTSKKVIRRRRRRRRRGVATASSEGPGRRLSASKRLAEQMGVKSEGFQSSHLSGGT
ASSFSLFGNANDLEYFSDSEPDAVSQISSAGLGSTAVQTSVRIGSIGAPRIRKALLQGKA
RIAAPPTAPTSAPAADILSSILDLQDRWHDASRNLGEVHIRADGTLNIPQRPAPTATEAP
LPKAGTSKTEKHLTQAPLYQQGGGGPNYNRGGGAGSSDSYNNRYSGNTSYRGGGGGGAGG
SSGGSGVPSSSGEASSRHLTGEGDGQGGGGFGNQNFSSSGSNNNTNMSSFIPFHLRFNTP
TRQQQPRQQNVLPANQPTPPFPGSAPPPAPVASSSNNFSGQTPMFAAPLNHHPAPVMGMP
VVLSIPPPPMPPASLPWNSPLFKITPLQQAPAKSNDGNQNDDVDNCPNFSIYSQESQAVA
NASAMPSGVPHGPADASDKDDDDMNEDLVQLDDDDEDTDIPLPLGPEPEPVPEKVPKSSD
DDLYEPENPTEEPEEPEMFEESCDAVPTEKSESSDHEPSNSNVQAAAPEENDAEEARTRS
TPSPLVKEDRAADRDRAKGVLELYDDSDWEELDIDKPKEFEKALLTETEAQVSPKRAPSK
RPPSKKDTSLERDVNESGSEHEQDRSYTPCLDEKNLAEEEEAGTTHQNNVSTSPKTRSSK
VSGDEDEPEKAVGTDIQSEDELNNENESPRRSRSRGTANNKKDKSKSRSKRNKGETFKKV
GKRQKDRNYRGDKSEPDRSPRPDSRSLTPKMRSKSPRVSKSISRSRSGSRSRCKSKSFSR
SRSRSPSRSRNRRRRNSRSKSYSRSHSRSRSRSNSHSRQRFSFRGRDHQRGFFRGRGGLR
LNYRNQQFHNRPFQHYGQNYHQNQNYHHQHNQHQNYFPPNQHGQHQQYFQRPKRRELPRY
DVRNVVGTSRHQTQAKDRYGRDAMRSHRSRSGRRNSRSFSRSVSRDSRVSLRSRSGSPKR
RSFSMSPTPPPGTSPPPHKHGRGRQTSTNRRYARSPSPAPSPRNERATSPVQSVHSRRSR
SHTPNRINGDGNRSSLYMGSPHYTPRISRSRSRSRSKSPKDMHKKKKKKSDKKKRRKRTG
SSSPTTAARMRRISRQRDPFEDADDFLAPQRKRKKAGITTGQWSPSPSPGRCDFLHDSAL
QDKNSSWTPPLGTPKGGHYNNDGGLTPKKTKRKRDKSKKKRKQHQLEKPRKEKKRKRRTQ
TPEPLPSKEVFASGNNILVSVSFNKESNTNNASATLSSQQQSVVTIPPGREDLLSNRMTS
MTSMASMASNSNICSAVGAVKKTKRKRKKLEAKPVAIIDLERSPFQVHQEPADVIVLTDS
EDATEPLSSRRERERDRDHELMRENGQREKTPQVGSLDAIMETSYENMTQSTGPKTPPEP
PLVKFNLPTKKIQHKVRNNPLHEDVDDINSADELEASCSMAPAEQTPQHGHASHDGGQKI
GPNTPPESGPCSPDAYDPFEPTKSPSLSPRSPTLTPSQNLDQQTVSMPASGAIGPGSGDK
GESDGAHVTGSNASTNTQAQGNALNPVDLVMALMNKPNQSGSIQQESEVSSAQYISSSSL
SLSLGVGSSTGGGGGGAGGGDNHDKTADGKTITVLSNVLLTSSSVVSSSQHIPSISSPTP
PSKKLTPLPKAGGSVASSSSGVGNIPTTSSGIGGTRNGSGLGNAGGSSNALDDSFSMEIE
SPYSPGSADYEDLFEPPIPLEASRRAKGGATGGKVEIFDNLFGSSSPISNIRMTSRYNTA
VGKKSNRTKADRKSKVKGARNPDFYDDVPNSATDLQNKDRLLRKLNRQERVVEEVKLVLK
PYFNKKAITKDDYKDIMRRAVPKICHSRSGEINPHKIKNLIDAYVRKFRAKHKKLSLLNT
GQVSSAVKCAAYLKKL
Download sequence
Identical sequences Q9VNE0
FBpp0078401 FBpp0078401 NP_649554.1.81976 FBpp0078401 7227.FBpp0078401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]