SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078603 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078603
Domain Number 1 Region: 344-707
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.31e-84
Family beta-glycanases 0.00000192
Further Details:      
 
Domain Number 2 Region: 41-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-37
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 225-347
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000576
Family beta-Galactosidase/glucuronidase domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078603   Gene: FBgn0037215   Transcript: FBtr0078964
Sequence length 908
Comment type=protein; loc=3R:join(23137..23284,23459..23593,23981..24494,24552..24648,24727..25015,27565..28044,28098..28519,29504..29884,29935..30195); ID=FBpp0078603; name=CG12582-PA; parent=FBgn0037215,FBtr0078964; dbxref=FlyBase:FBpp0078603,FlyBase_Annotation_IDs:CG12582-PA,GB_protein:AAF52172.2,REFSEQ:NP_649436,GB_protein:AAF52172,FlyMine:FBpp0078603,modMine:FBpp0078603; MD5=bbc1d25838059fa941bfc841ed7f3ef5; length=908; release=r5.30; species=Dmel;
Sequence
MKYGCGLLRNGTTGAVMVGLVCGLYVCSGQCDKVEVIELSNWTITNQNGSLTIANQTLPL
GIYSAFAPQVLDSYNDVGLRYLAYDNFTFSNFFQFDVHHFNRGHINLTFHGIDTVSEIRL
NHQLLGRTDNMFVRYSYEVSSLLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPN
ERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSY
WNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGK
VVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGV
GNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQISHLLRSAKEAHMNMLRVWGGGVYES
DYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNE
NEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPD
NYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDL
LGLITHRQHHPLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMATKVETELYRS
LRDTPHRTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDS
LNISLICDQLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQG
EFTRTNAFLELQLRRGQDVISRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNS
VSISIQVKRPAVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRV
LTVNDFMR
Download sequence
Identical sequences Q9VMY5
FBpp0078603 FBpp0078603 FBpp0297164 NP_001246899.1.81976 NP_649436.2.81976 FBpp0078603 7227.FBpp0078603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]