SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078694 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078694
Domain Number 1 Region: 78-182
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.56e-24
Family Ribosomal proteins L24p and L21e 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078694   Gene: FBgn0031651   Transcript: FBtr0079058
Sequence length 247
Comment type=protein; loc=2L:complement(4944301..4944416,4944475..4944864,4944927..4945080,4945192..4945275); ID=FBpp0078694; name=mRpL24-PA; parent=FBgn0031651,FBtr0079058; dbxref=GB_protein:AAF52176.1,FlyBase:FBpp0078694,FlyBase_Annotation_IDs:CG8849-PA,REFSEQ:NP_523476,GB_protein:AAF52176,FlyMine:FBpp0078694,modMine:FBpp0078694; MD5=dd30e0fc45f52f0f60a40f126f576f5b; length=247; release=r5.30; species=Dmel;
Sequence
MRLTQYLASKLKNFSNLPKEYIERSKKQVYWQTPKEINYLPRTVERKRFRYTTNRSWTGQ
FRQQNMPGTVRRKVLVEPIEDWSFFRGDRIEVLVGKDKGKQGIVTQVIPERNWVIVEGLN
WHYRKVGGEKEFPGIIIKSEAPLHVTKDIRLVDPSDLQGTDFEWRFTEEGEKVRVSLRSG
RIIPIPETNNQTHDYKTPNAYIEREKDTPGAVVGEITFQPKLSTFEMDIMEEMGIKEERT
PVKSYWY
Download sequence
Identical sequences Q9VMY1
FBpp0078694 FR168 FBpp0078694 FBpp0078694 NP_523476.1.81976 7227.FBpp0078694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]