SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078861 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078861
Domain Number 1 Region: 44-382
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.53e-92
Family Glycosyl hydrolases family 35 catalytic domain 0.00041
Further Details:      
 
Domain Number 2 Region: 497-653
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-28
Family Beta-galactosidase LacA, domains 4 and 5 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078861   Gene: FBgn0001089   Transcript: FBtr0079230
Sequence length 672
Comment type=protein; loc=2L:complement(6003762..6004854,6005006..6005153,6005213..6005552,6005686..6005836,6005904..6006067,6006567..6006689); ID=FBpp0078861; name=Gal-PA; parent=FBgn0001089,FBtr0079230; dbxref=FlyBase:FBpp0078861,FlyBase_Annotation_IDs:CG9092-PA,GB_protein:AAF52321.2,REFSEQ:NP_608978,GB_protein:AAF52321,FlyMine:FBpp0078861,modMine:FBpp0078861; MD5=73f3402e68f9d91eec61cfe5f4756c6b; length=672; release=r5.30; species=Dmel;
Sequence
MSGCRRNRKLTMAVSGCLIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQ
PFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVK
FLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAEL
MPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEK
MSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRD
GQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDE
AGGVTTKYNLVKAVIGEFLPLPEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPV
ESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQ
IYSLPLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFP
LEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVA
YVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATGEDLPAVQFDAVA
QLDGESGDVPLK
Download sequence
Identical sequences Q9VMJ5
FBpp0078861 7227.FBpp0078861 FBpp0078861 FBpp0078861 NP_608978.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]