SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078894 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0078894
Domain Number - Region: 24-77
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0225
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078894   Gene: FBgn0031822   Transcript: FBtr0079264
Sequence length 111
Comment type=protein; loc=2L:complement(6490216..6490222,6490288..6490373,6490439..6490629,6490706..6490757); ID=FBpp0078894; name=CG9548-PA; parent=FBgn0031822,FBtr0079264; dbxref=FlyBase:FBpp0078894,FlyBase_Annotation_IDs:CG9548-PA,GB_protein:AAF52393.2,REFSEQ:NP_609038,GB_protein:AAF52393,FlyMine:FBpp0078894,modMine:FBpp0078894; MD5=1b1fa5e59d31a189d26fcbf79226026f; length=111; release=r5.30; species=Dmel;
Sequence
MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY
Download sequence
Identical sequences A0A0Q9WB69 A0A0Q9X477 A0A1B2AJZ5 A0A1W4VED9 B3N5S5 B4I1W7 B4N7N1 B4P0C9 B4Q4N9 Q9VMC8
7227.FBpp0078894 7245.FBpp0263445 7260.FBpp0247833 NP_609038.1.81976 XP_001970025.1.56816 XP_002038106.1.34323 XP_002069384.1.14588 XP_002078381.1.80810 XP_002088175.1.41174 XP_015020561.1.58863 XP_015025174.1.90633 XP_016924813.1.48971 XP_016964669.1.21709 XP_016982910.1.97277 XP_017011797.1.47939 XP_017033803.1.37106 XP_017050406.1.74164 XP_017070074.1.81094 XP_017111472.1.32376 XP_017859496.1.65068 XP_020803936.1.32911 FBpp0199409 FBpp0247833 FBpp0263445 FBpp0078894 DS10_00001399 FBpp0142162 FBpp0078894 FBpp0220972 FBpp0078894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]