SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078942 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078942
Domain Number 1 Region: 302-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078942   Gene: FBgn0031850   Transcript: FBtr0079313
Sequence length 419
Comment type=protein; loc=2L:complement(6690051..6690139,6690977..6691098,6697010..6697127,6697263..6697457,6699765..6699902,6699987..6700116,6700181..6700496,6700553..6700619,6701750..6701834); ID=FBpp0078942; name=Tsp-PC; parent=FBgn0031850,FBtr0079313; dbxref=FlyBase:FBpp0078942,FlyBase_Annotation_IDs:CG11326-PC,GB_protein:AAN10592.1,REFSEQ:NP_723203,GB_protein:AAN10592,FlyMine:FBpp0078942,modMine:FBpp0078942; MD5=9db2bb808b0abfd16963064630133298; length=419; release=r5.30; species=Dmel;
Sequence
MNWTRVLLIGLTALALTFVDVASLSLDPVASAELEQFIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLHVDCKASTHHDIDMNLAKLYTQMDDPVIKLFRERKYPLHFDGDMEHSLQRANCQ
KGNHRRGNRRMLRNKITEREKNKKRDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIPVL
NGDCEDALARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKNPLTTDNQLRIEP
DCRSANPCYPGVECLDSAAGPRCGHCPLGFIGDGKSCKPGVTCAHHMCYPGVQCHDTVNG
AQCDSCPAGYEGDGRTCSLRNPCLDTPCPSGNILVPSHNVQHYQRQSQYTARKYSVVTN
Download sequence
Identical sequences Q8T0I9
NP_723203.1.81976 NP_723204.1.81976 NP_723205.1.81976 FBpp0078940 FBpp0078942 FBpp0078943 FBpp0078940 FBpp0078942 FBpp0078943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]