SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079167 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079167
Domain Number 1 Region: 2029-2204,2356-2374
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000843
Family WD40-repeat 0.039
Further Details:      
 
Weak hits

Sequence:  FBpp0079167
Domain Number - Region: 4264-4446,4659-4771
Classification Level Classification E-value
Superfamily ARM repeat 0.000201
Family Armadillo repeat 0.061
Further Details:      
 
Domain Number - Region: 3863-3933,3992-4065,4123-4139,4250-4349
Classification Level Classification E-value
Superfamily ARM repeat 0.0158
Family Mo25 protein 0.082
Further Details:      
 
Domain Number - Region: 3815-3856
Classification Level Classification E-value
Superfamily Zinc hairpin stack 0.0484
Family Zinc hairpin stack 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079167   Gene: FBgn0011230   Transcript: FBtr0079545
Sequence length 5322
Comment type=protein; loc=2L:complement(8054511..8054593,8054657..8056253,8056309..8058244,8058302..8058784,8058841..8060504,8060566..8061258,8061308..8061512,8061570..8067555,8067625..8068152,8068214..8070380,8070636..8071048,8071172..8071266,8071448..8071566); ID=FBpp0079167; name=poe-PA; parent=FBgn0011230,FBtr0079545; dbxref=FlyBase:FBpp0079167,FlyBase_Annotation_IDs:CG14472-PA,GB_protein:AAF52598.1,REFSEQ:NP_476986,GB_protein:AAF52598,FlyMine:FBpp0079167,modMine:FBpp0079167; MD5=b7b6a19b9d21da62baebd71068062a18; length=5322; release=r5.30; species=Dmel;
Sequence
MSAHSGGTDWNSVVKALILNRTGALNKNEVVNLLKAITRCEHDFFEEESNFTQFYTAFAA
LAADKLMQIKTICQTQICQLHDATAVLIRFIIYRLPRVSVYETKWLLGALKMLCEGRECP
ASASSSMFDYNAVANVLKSCKHPESTTKSIMPSSSSSGSGASNDKESPKSEIKRSRSDLS
SVILQQLIAPLEPGKMTWVPLSEEVTDCTEQILAANVEYFQEQNGVDTLLDVCVSLPILN
RYRSKYMETINGGKSLYLPLTQVEATAVKSSMNHMLTDLTILSQAQALIEMQPLTPSRIE
RLSMCGIAALYNAVLTSIATSVLGMSQASSSQKQTASTSQGSGVGGSSGGQSNKDHDDFE
DQACSIVNKALEIYSNIGHMFKTSARIHVYQNHLCYGSWLLISGIQGAMGASGSGGSSSD
SASKSASKATKSGSEAGTAPTTPIARVNLFKVQQGFGELNAAIANHSIKLLSELIEDLKV
EAACGQSLESTELPEPAQFDILQNYSSLERIVRVLNTATLHQLFTFLATVAYRKACTLKR
ASAKDRTECEPISYSDSTTYFNDSLSCSDNSEEDDSESYLGHWFKETLSPETHDDNANTS
TQERAEQKSALVPKLDEPHEYLDLAADIFCFLDQFLANRHAYMQRYVKAGVSDQQMLLMA
NIIKDFDRDVMRNESDQGSGNAPAASAGAGTSAGASTKWQTSMIRFSGAAGRYIHNLIST
SLLSEQLQSNLLQHLSISPWSTDTNTWPLQVYPSTLSVLVQILLLKPTQEKEAACLSVWH
RLINTLVEGVCSSNTASDSDYEDLNIEHAQLLLFLFHSLNLMQKKSILLLTAGGVIRCAE
VCRGISEDRPVKNSQIMLLSRLLLFLEYLMKHLYNAPPELLDQVRWNLFSVSSMPDTQKI
TDLLNCRTKLNSYCRHDIEENFRKSAGEYGSSIRPTFYSLVMGDPEISYWAQEFKLDGLA
WNFILCTPDKLKYPLLVDALTDILSITDMSMYSKEKDKEASMHNLCAIQYCFTIAWKLNL
GLPPSTSHVESLKAERSPNLHSLMWSIRLPLASSHYLVVSSLIKQGMYTQYAETLWTHVG
DIGADIKYSLKQTILGVEAFNSQMNGNGTPRLSDLILFDSLVAHMQAVAWANKEGLKWPR
KESEDAAGEQSAGTSLTSSSNDPELYSSNESIDDQKLKQDDDGKLSSDLQKYNQLVNELM
VKLMNSYQLLSVIVRGQMLKQLSSSTPEKALNLIVPIVSDKPAIMLELHAAFLKLLPNED
KQLIANEWPKCLMVNDFAFNGKQHPVEPYILNVIDAHIIELTRGSNYSTLHTLKHCLKSI
LQLFELLLPHRTANAEVETQLKQLLISSMLDMRTDYLQGHSEHCLREILSGLTQEAQKLL
LYEHMVGYCYRMLKEFAADLRQPQSAGPSGGAPLDQDRAMFNESMLFAVLKTMFKMLEKP
VAVQAMRQFFKDQRSGSLTTLLLSFTGTSLPVSYARKMLQFVNRLFQLSLQADSQFQHED
LVECFSELATVDVARLKQWLGHIIYGPNVSTDVSTSEALDTTCRMLTSILQPSSSSSSNA
QTPTNMATVSAMPSISDQLDPMEIEYDCGTAAGGGESNPGTGGAAANTSQILSLWQAAQP
NPSEESSQACDHSDSERNGALLLSFVKSLVKDQSKASQIAPPLFQALLQLGQTLISPPQE
GCDFADVLQIMITLADASPARGHVALFNTTLLWLELAKLQLPDKHLKHAENVSAQLRYLS
ELLQSIGFRGSRQHNPPWDDELQTDIDELYDELAEEGEQDSLLDDSDEDTLNNKLCTFSQ
TQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQA
LSRRIGSNEVRDSAGIGSYLPSHMSLLAGKKRSSLPVGQPVLTRKDSLTNERIAVLTKLL
EPYRETLQHQDQWLLVVRCILEYFDLLLPSINENCMLYSIVGCHKRATAALERLHLLEQS
FQVTDQLMFATLGSQEGAFENVRMNYSGDQGQTIKHLLSSGVVRRVAFCCLSSPHGRRQQ
LAVSHEKGKVTILQLSALLKQADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVCG
LKECHILTFSSSGSTNEHIVVNPQLENGNYIKKAVWLPGSQTLLAVVTSDYVKIYDLAVD
TYSPKYYYLVAVGKIRDCTFVYQDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL
ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTN
SASKSASKGPLQPLVQWTEVTGHPGLVYASMQTSNNPIILMITPERIYLQEIKAQSAKSR
IMDVVGIRHAVAGVEKTTLLLLCEDGSLRIFSAQPEYTSFWLSPQVQPFGNQLYSSTLMA
KGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEFGGND
LLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQS
VTILGRTIPTPVRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGKSK
ELVGWPDESEDVTVPGSSAPAVSSSQASSANFGEGFNCITQLDRMANHLLEVMDCALHLL
GSGVPASMRQKAVKTASALLLLPTPNPVQTQARYVLATLYGTRALYHNYKDGVLLQFVNR
ELQSMQPKLEKLETLREIDPEAFYRLVLMVRGIANARPQSLAKICVENNYDIVPTLMGIV
LELHKVTPTLDEPVNIVKRGLCQPETIVHCLVEIMYGFALADPGQVGRMTKYFIDLLKHD
ASVISHSAKEALILLLSPRMKRRKVAIVTPPACSTPTPSTSTMQALQAAASSAASDIIEE
AAGVVVDGSVGGGGLPEPNADAEGAAVGVGGVGQQQMLNLEAFMGGGFPRLLGLPEDADD
EAIMDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDE
GSNVATDGSTLRTSPAEPAGSGGSESGGSGVESIGGTSARSSNFGDHANASPPRQGSTKD
DQEQPGPSGVAGSGGVAVLSAMSSSEDNEANEDDKLSKLHDLRIAVLESIIQHLGTFDLC
NGLQAIPLIQVILMLTTDLNGNNERDQQVLHDLLTALVDYVEIGKRGAAARMETKCPGNE
VRLALLSLFGVLMGKTKSKQTGTTSPPHQFKDNSSFVASTTANVLSKSGAFVYALEALNT
LLVHWKNVLGDPYAAGGGLASQSAQASGGASGPGVQLLKPIKHGPKPDISILIPHNYLKN
YPDIFESYDGLLTEIIVRLPYQILRLSSAHPDNYDSGFCEAMTFTLCEYMMLNLNTLLRR
QVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTGAPYNANPPMLSYDALV
ELTEHLRTCQEISQMRTGNWQKFCVVHEDALAMLMEIACYQLDDGVSPIIIQLLQAAVCN
LPPPSGSKQAQPQPSTSSASGKLRTDREKSEDTDAYYSKFDPAQCGTFVHQIFRYACDAL
IIRFVRIFLLENNITQLRWQAHSFMTGLFEHANERQREKLLNIFWNLWPLVPTYGRRTAQ
FVDLLGYLTLSTRSITERLPEFVSRAVDVLRQQNELLCKHPNAPIYTTLESILQVNGYYL
ESEPCLVCNNPEVPMANIKLPSVKSDSKYTTTTMIYKLVQCHTISKLIVRIADLKRTKMV
RTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSAQTELKIDFPLPITACNLMIEFADF
FETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCK
YAKFDFSMYARVCCAVDPIESAEDRVKTVSLIHSSLERADRNYRQLLTNKQMLELLIQKV
AEHRSSDRMVEDNMASVHSTSQVNKIIQLLAQKYCVESRTSFEELSKIVQKVKACRSELV
AYDRQQQDQPPVNPGSTTGAENPTTNRCYGCALASTEQCLTLLRAMAYNYDCRVCLYSQG
LVSELAEHNLRRGTPLIQEEVRNLLVVLTKDNAEACMHLLQLVTTRVKNALMGSIPLISL
EAAVHQEMTLLEVLLGQDDICWEYKLKVIFELFISNCRLPRGPVTAVLHPCLRIMQNLIC
PVLPGSKPNQKVATTDLCSMKMFEGNTVDYRAWLNSDRNHEYAAWSKRMPSNNQAKLKNA
KDQNVAASGGSDAPPKSRREVRVAFLSEKYGKRWRERVLDKQRVIKPLVFNAKWIQPLLF
NANSRFGRQLACSLLSSLSRTNERRQQALNMLTSFLKHVGEAGEASAEYLMLYKNMATEQ
PWLQYLVLKGVLSQISQLLAIEISKVHRMEEYSLSSDLSLGYALRQYVELLWLLLECPNI
RRTYKTRMLGPVLESYLALRSLVVQRTRLIDDAQEKLLEMLEDMTSGTEEETRAFMEILI
DTVEKTRMNDIKTPVFVFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPS
SEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGG
DRDAMRIVYRMRGLLGDATEEFVETLNNKSQEQVDTEQLYRMANVLADCNGLRVMLERIG
SLQRISRNRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQS
AVTEQLLEIMETILSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSVLRHL
IRVLAALVYGNEVKMALLCEHFKDTLNFNRFDNERTPEEEFKLELFCVLTNQIEHNCIGG
TLKDYIVSLGIVERSLAYITEHAPCVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNH
HEATQVAISKDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDSATAARVQQVRDFTRAEK
KRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLRDETGLTCFICREGYACQPDKV
LGIYTFTKRCNVEEFELKSRKTIGYTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNA
NTRCNGLLPLWGPAVGEAAFSACMTRHSSYMQESTQRCDISYTSSVHDLKLLLVRFAWER
SFHDDAGGGGPQSNMHFVPYLLFYSVYLLLSSRSAARDSKTLLTYLQAPPSEKWLECGYE
VDGPLFMATISLSLHSRELWNKHKLAHLKRMIAVAQGRHVSPAVLCKALLAPADRQVKDY
TVYKPFLMMWALVDLIYDNLFKTVSTPKEEDWPISLFDYLRKNDEALLKSTDSILQTLTE
EFLPCTSFVEFCDVAGLLHLIEHPDNFIEEILAALPSTSSSN
Download sequence
Identical sequences M9PB68 Q9VLT5
FBpp0079167 FBpp0079167 FBpp0305301 FBpp0079167 NP_001260222.1.81976 NP_476986.1.81976 7227.FBpp0079167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]