SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079313 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079313
Domain Number 1 Region: 182-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0079313
Domain Number - Region: 33-89
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00549
Family Apolipoprotein A-I 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079313   Gene: FBgn0001137   Transcript: FBtr0079708
Sequence length 295
Comment type=protein; loc=2L:complement(8431542..8431741,8431877..8432494,8433013..8433082); ID=FBpp0079313; name=grk-PA; parent=FBgn0001137,FBtr0079708; dbxref=GB_protein:AAF52675.3,FlyBase:FBpp0079313,FlyBase_Annotation_IDs:CG17610-PA,GB_protein:AAF52675.4,REFSEQ:NP_476568,GB_protein:AAF52675,FlyMine:FBpp0079313,modMine:FBpp0079313; MD5=5719d3077127993f07e0dc78da2f485e; length=295; release=r5.30; species=Dmel;
Sequence
MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQ
ETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIIL
GSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQM
LPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQ
RKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC
Download sequence
Identical sequences P42287
FBpp0079313 FBpp0079313 7227.FBpp0079313 NP_476568.2.81976 FBpp0079313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]