SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079468 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079468
Domain Number 1 Region: 11-125
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-40
Family FKBP immunophilin/proline isomerase 0.0000118
Further Details:      
 
Domain Number 2 Region: 248-395
Classification Level Classification E-value
Superfamily TPR-like 3.35e-29
Family Tetratricopeptide repeat (TPR) 0.00006
Further Details:      
 
Domain Number 3 Region: 124-234
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-25
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079468   Gene: FBgn0029174   Transcript: FBtr0079872
Sequence length 439
Comment type=protein; loc=2L:join(9888143..9888338,9888404..9888546,9888667..9888787,9888847..9888985,9889048..9889405,9889460..9889570,9889632..9889769,9889877..9889990); ID=FBpp0079468; name=FKBP59-PA; parent=FBgn0029174,FBtr0079872; dbxref=GB_protein:AAF52818.1,FlyBase:FBpp0079468,FlyBase_Annotation_IDs:CG4535-PA,REFSEQ:NP_524895,GB_protein:AAF52818,FlyMine:FBpp0079468,modMine:FBpp0079468; MD5=0cba52e8ed40bf222c6e1861d81c13b2; length=439; release=r5.30; species=Dmel;
Sequence
MPEGNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFE
FSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGWK
GEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAI
GIIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEE
WKLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATH
SNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQL
EPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAANDKETEPPRETDVLSKCGEWSE
EDAKREAELTLERDNIIMI
Download sequence
Identical sequences Q9VL78 X2J5E8
FBpp0079468 FBpp0079468 7227.FBpp0079468 NP_001285784.1.81976 NP_524895.2.81976 FBpp0079468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]