SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079636 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079636
Domain Number 1 Region: 202-284
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-19
Family PHD domain 0.0043
Further Details:      
 
Weak hits

Sequence:  FBpp0079636
Domain Number - Region: 69-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000196
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079636   Gene: FBgn0005683   Transcript: FBtr0080046
Sequence length 582
Comment type=protein; loc=2L:complement(10420828..10422462,10422530..10422643); ID=FBpp0079636; name=pie-PA; parent=FBgn0005683,FBtr0080046; dbxref=FlyBase:FBpp0079636,FlyBase_Annotation_IDs:CG5354-PA,GB_protein:AAF52945.1,REFSEQ:NP_524740,GB_protein:AAF52945,FlyMine:FBpp0079636,modMine:FBpp0079636; MD5=f2c1932aac98b28d3fdc2b3a90094afa; length=582; release=r5.30; species=Dmel;
Sequence
MEDNKELQCLICKYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHLPQRGGDSSGILGFLLR
DIREEAAAAEKRKCWYCNKIGASLQCDRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRP
MDDYKRQLQSNPPRNATCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSGYYL
RCIWCRSERFRDSIRLQSVFVPDRDATWEKQRNAYRELHERNLKCDQPNCLCPSGRTYNR
LSWVILCCSSCAATSAHLKCLVGALRLPKKRERTDFKCSMCLDVERRIAEGPARTTEETN
ADGDNQVDGSFYVQKLGPDAATRSLTQTPVFSEEDESERSSNITVIFSQPKSNATSERLS
LSPPQEEMIVEIPDSPEASPKTSIDENHSPQPIARRDTSDSPQPIAASEIPDSPQPTAAS
EIPDLPQTTAINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQAVAKAPN
SPSLPKEDPNTLLVLKSGFQCPGEPFFYLVIYEFEHGTCMGECIGTCVLRFKEDDPRIQD
TSQAALERVNITPDDVWCRSEDRGIFEHIEKFHEWYRSEGFS
Download sequence
Identical sequences Q9VKW2
FBpp0079636 FBpp0305674 NP_001260348.1.81976 NP_524740.2.81976 7227.FBpp0079636 FBpp0079636 FBpp0079636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]