SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079895 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079895
Domain Number 1 Region: 303-539
Classification Level Classification E-value
Superfamily TPR-like 1.71e-28
Family Tetratricopeptide repeat (TPR) 0.0069
Further Details:      
 
Domain Number 2 Region: 89-186
Classification Level Classification E-value
Superfamily TPR-like 2.08e-23
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079895   Gene: FBgn0032397   Transcript: FBtr0080311
Sequence length 589
Comment type=protein; loc=2L:complement(12036271..12037064,12037155..12038130); ID=FBpp0079895; name=Tom70-PC; parent=FBgn0032397,FBtr0080311; dbxref=FlyBase:FBpp0079895,FlyBase_Annotation_IDs:CG6756-PC,GB_protein:AAN10798.1,REFSEQ:NP_723712,GB_protein:AAN10798; MD5=e8b1482c65ac2a5ee7a6c2be549f0d73; length=589; release=r5.30; species=Dmel;
Sequence
MAMTLNIGSMKLTKWQLALILGTPLAIGLGTYAVKSWTAASKELDGEKKRPKAKIEKQAI
SLDGTAPDQELERNQKSAELGEKLSPLKEANNYKTEGNNCYRNGKYDEAIKFYDKAIDKC
PKEHRTDMAIFYQNRAASYEMLKKWSNVKEDCTASLEFNPRYAKAYYRRARAHEATKDMN
ECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSF
IADPLQTMKVPAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSEAEAQYKVEALL
MRGTFHLLCGSYVESQQDFDAIIANDYADPNLRAYAYIKRAALYIQLDQREKGIADFAEA
ERLNPENPDVYHQRAQILLLLEQIEPALAEFEKAVSIAPNHAIAFVQKCYAEYRLSLLAG
DQRRLESVMHTFQNAIERFPSCVECYSLTAQVLADQQQFTQAEEYYKKAMVLAPTNPALI
VHQAIMVLQWRGDINLAVQLLNKAIEVDPKCELAYETLGTVEVQRAQLTRAVELFEKALL
YAKSQAELVHVYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGVA
Download sequence
Identical sequences Q9VKC8
FBpp0079893 NP_609536.1.81976 NP_723711.1.81976 NP_723712.1.81976 FBpp0079893 FBpp0079894 FBpp0079895 FBpp0079893 FBpp0079894 FBpp0079895 7227.FBpp0079893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]